Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

USP46 blocking peptide

USP46 Peptide - middle region

Reactivity
Human
Synonyms
USP46; USP46 Peptide - middle region; USP46 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDF
Sequence Length
366
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for USP46 blocking peptide
This is a synthetic peptide designed for use in combination with anti- USP46 Antibody, made

Target Description: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes.
Product Categories/Family for USP46 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 46 isoform 2
NCBI Official Synonym Full Names
ubiquitin specific peptidase 46
NCBI Official Symbol
USP46
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 46
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 46
UniProt Gene Name
USP46
UniProt Entry Name
UBP46_HUMAN

NCBI Description

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM, Jun 2009]

Uniprot Description

USP46: Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2. Belongs to the peptidase C19 family. USP12/USP46 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 4q12

Molecular Function: protein binding; ubiquitin-specific protease activity

Biological Process: ubiquitin-dependent protein catabolic process; behavioral fear response; protein deubiquitination; righting reflex; adult feeding behavior; behavioral response to ethanol; regulation of synaptic transmission, GABAergic

Research Articles on USP46

Similar Products

Product Notes

The USP46 usp46 (Catalog #AAA3246646) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The USP46 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGKLKNGNMN EPAENNKPEL TWVHEIFQGT LTNETRCLNC ETVSSKDEDF. It is sometimes possible for the material contained within the vial of "USP46, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.