Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UBP46Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit USP46 Polyclonal Antibody | anti-USP46 antibody

USP46 Antibody - middle region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
USP46; Polyclonal Antibody; USP46 Antibody - middle region; anti-USP46 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYME
Sequence Length
354
Applicable Applications for anti-USP46 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human UBP46
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UBP46Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UBP46Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-USP46 antibody
This is a rabbit polyclonal antibody against UBP46. It was validated on Western Blot

Target Description: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM, Jun 2009]
Product Categories/Family for anti-USP46 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 46 isoform 2
NCBI Official Synonym Full Names
ubiquitin specific peptidase 46
NCBI Official Symbol
USP46
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 46
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 46
UniProt Gene Name
USP46
UniProt Entry Name
UBP46_HUMAN

NCBI Description

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM, Jun 2009]

Uniprot Description

USP46: Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2. Belongs to the peptidase C19 family. USP12/USP46 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 4q12

Molecular Function: protein binding; ubiquitin-specific protease activity

Biological Process: ubiquitin-dependent protein catabolic process; behavioral fear response; protein deubiquitination; righting reflex; adult feeding behavior; behavioral response to ethanol; regulation of synaptic transmission, GABAergic

Research Articles on USP46

Similar Products

Product Notes

The USP46 usp46 (Catalog #AAA3214289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP46 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's USP46 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP46 usp46 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RDFSNTETLC SEQKYYCETC CSKQEAQKRM RVKKLPMILA LHLKRFKYME. It is sometimes possible for the material contained within the vial of "USP46, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.