RASA3 blocking peptide
RASA3 Peptide - N-terminal region
Gene Names
RASA3; GAPIII; GAP1IP4BP
Reactivity
Human
Applications
Western Blot
Synonyms
RASA3; RASA3 Peptide - N-terminal region; RASA3 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLL
Sequence Length
834
Applicable Applications for RASA3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RASA3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RASA3 Antibody, made
Target Description: The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane.
Target Description: The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane.
Product Categories/Family for RASA3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
ras GTPase-activating protein 3 isoform 1
NCBI Official Synonym Full Names
RAS p21 protein activator 3
NCBI Official Symbol
RASA3
NCBI Official Synonym Symbols
GAPIII; GAP1IP4BP
NCBI Protein Information
ras GTPase-activating protein 3
UniProt Protein Name
Ras GTPase-activating protein 3
Protein Family
UniProt Gene Name
RASA3
UniProt Entry Name
RASA3_HUMAN
NCBI Description
This gene encodes a protein that binds inositol 1,3,4,5-tetrakisphosphate and stimulates the GTPase activity of Ras p21. This protein functions as a negative regulator of the Ras signalling pathway. It is localized to the cell membrane via a pleckstrin homology (PH) domain in the C-terminal region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Uniprot Description
RASA3: Inhibitory regulator of the Ras-cyclic AMP pathway. Binds inositol tetrakisphosphate (IP4) with high affinity. Might be a specific IP4 receptor.
Protein type: GAPs, Ras; GAPs
Chromosomal Location of Human Ortholog: 13q34
Cellular Component: cytoplasm
Molecular Function: metal ion binding; calcium-release channel activity; GTPase activator activity
Biological Process: negative regulation of Ras protein signal transduction; signal transduction
Research Articles on RASA3
Similar Products
Product Notes
The RASA3 rasa3 (Catalog #AAA3244436) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RASA3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RASA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RASA3 rasa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEAWYFLQPR DNGSKSLKPD DLGSLRLNVV YTEDHVFSSD YYSPLRDLLL. It is sometimes possible for the material contained within the vial of "RASA3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
