Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '27336'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.82 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '27336' and pd.language_id = 1
Query
Database
3.21 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '27336'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.14 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '27336'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '27336' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '27336'
⇄⧉specificity => string (379) "This assay has high sensitivity and excellent specificity for detection of E...
$value['specificity']
This assay has high sensitivity and excellent specificity for detection of ERO1L. No significant cross-reactivity or interference between ERO1L and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between ERO1L and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value['purity']
⇄form => string (3) "N/A"
$value['form']
⇄concentration => string (3) "N/A"
$value['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name => string (31) "ERO1 like protein Alpha (ERO1L)"
$value['products_name']
⇄products_name_oem => string (47) "Human ERO1 like protein Alpha (ERO1L) ELISA Kit"
$value['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value['products_name_syn']
⇄products_gene_name => string (5) "ERO1L"
$value['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value['products_gene_name_syn']
⇄⧉products_description => string (1402) "Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immun...
$value['products_description']
Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-ERO1L antibody and an ERO1L-HRP conjugate. The assay sample and buffer are incubated together with ERO1L-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the ERO1L concentration since ERO1L from samples and ERO1L-HRP conjugate compete for the anti-ERO1L antibody binding site. Since the number of sites is limited, as more sites are occupied by ERO1L from the sample, fewer sites are left to bind ERO1L-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ERO1L concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This ERO1L ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human ERO1L. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value['products_references']
⇄⧉products_related_diseases => string (210) "Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!I...
$value['products_related_diseases']
Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!Insulin Resistance||2!!Liver Diseases||2!!Glucose Intolerance||1!!Liver Neoplasms||1!!Atherosclerosis||1!!Ischemia||1!!Hyperglycemia||1
⇄products_categories => string (3) "N/A"
$value['products_categories']
⇄products_search_terms => string (3) "N/A"
$value['products_search_terms']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
$value['ncbi_full_name']
⇄ncbi_full_name_syn => string (25) "ERO1-like (S. cerevisiae)"
⇄⧉specificity => string (379) "This assay has high sensitivity and excellent specificity for detection of E...
$value->a['specificity']
This assay has high sensitivity and excellent specificity for detection of ERO1L. No significant cross-reactivity or interference between ERO1L and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between ERO1L and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value->a['purity']
⇄form => string (3) "N/A"
$value->a['form']
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name => string (31) "ERO1 like protein Alpha (ERO1L)"
$value->a['products_name']
⇄products_name_oem => string (47) "Human ERO1 like protein Alpha (ERO1L) ELISA Kit"
$value->a['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value->a['products_name_syn']
⇄products_gene_name => string (5) "ERO1L"
$value->a['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->a['products_gene_name_syn']
⇄⧉products_description => string (1402) "Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immun...
$value->a['products_description']
Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-ERO1L antibody and an ERO1L-HRP conjugate. The assay sample and buffer are incubated together with ERO1L-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the ERO1L concentration since ERO1L from samples and ERO1L-HRP conjugate compete for the anti-ERO1L antibody binding site. Since the number of sites is limited, as more sites are occupied by ERO1L from the sample, fewer sites are left to bind ERO1L-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ERO1L concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This ERO1L ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human ERO1L. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄⧉products_related_diseases => string (210) "Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!I...
$value->a['products_related_diseases']
Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!Insulin Resistance||2!!Liver Diseases||2!!Glucose Intolerance||1!!Liver Neoplasms||1!!Atherosclerosis||1!!Ischemia||1!!Hyperglycemia||1
⇄products_categories => string (3) "N/A"
$value->a['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->a['products_search_terms']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
$value->a['ncbi_full_name']
⇄ncbi_full_name_syn => string (25) "ERO1-like (S. cerevisiae)"
⇄⧉specificity => string (379) "This assay has high sensitivity and excellent specificity for detection of E...
$value->d['specificity']
This assay has high sensitivity and excellent specificity for detection of ERO1L. No significant cross-reactivity or interference between ERO1L and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between ERO1L and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value->d['purity']
⇄form => string (3) "N/A"
$value->d['form']
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name => string (31) "ERO1 like protein Alpha (ERO1L)"
$value->d['products_name']
⇄products_name_oem => string (47) "Human ERO1 like protein Alpha (ERO1L) ELISA Kit"
$value->d['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value->d['products_name_syn']
⇄products_gene_name => string (5) "ERO1L"
$value->d['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->d['products_gene_name_syn']
⇄⧉products_description => string (1402) "Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immun...
$value->d['products_description']
Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-ERO1L antibody and an ERO1L-HRP conjugate. The assay sample and buffer are incubated together with ERO1L-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the ERO1L concentration since ERO1L from samples and ERO1L-HRP conjugate compete for the anti-ERO1L antibody binding site. Since the number of sites is limited, as more sites are occupied by ERO1L from the sample, fewer sites are left to bind ERO1L-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ERO1L concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This ERO1L ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human ERO1L. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄⧉products_related_diseases => string (210) "Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!I...
$value->d['products_related_diseases']
Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!Insulin Resistance||2!!Liver Diseases||2!!Glucose Intolerance||1!!Liver Neoplasms||1!!Atherosclerosis||1!!Ischemia||1!!Hyperglycemia||1
⇄products_categories => string (3) "N/A"
$value->d['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->d['products_search_terms']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
$value->d['ncbi_full_name']
⇄ncbi_full_name_syn => string (25) "ERO1-like (S. cerevisiae)"
⇄specificity => string (53) "Recognizes human ERO1L. Species Crossreactivity: rat."
$value[0]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[0]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[0]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[0]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[0]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 1.5ug/ml<br>Applications are based on unconjugated antibody."
$value[0]['_source']['app_notes']
⇄⧉testing_protocols => string (844) "WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L...
$value[0]['_source']['testing_protocols']
WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L expression in PC-12.||AAA25091_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ERO1L is ~3ng/ml as a capture antibody.||AAA25091_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].||AAA25091_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody. Lane 1: ERO1L transfected lysate (54kD). Lane 2: Non-transfected lysate.||AAA25091_WB3.jpg!!WB (Western Blot)||ERO1L monoclonal antibody, Western Blot analysis of ERO1L expression in HeLa.||AAA25091_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.9kD).||AAA25091_WB.jpg
⇄⧉etc_term1 => string (260) "Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (N...
$value[0]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY!!Conjugate||FITC
⇄⧉products_related_diseases => string (246) "Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!D...
$value[0]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!Diabetes Mellitus||3!!Lung Neoplasms||2!!Insulin Resistance||2!!Liver Neoplasms||1!!Glucose Intolerance||1!!Ischemia||1!!Drug-Related Side Effects and Adverse Reactions||1
⇄products_categories => string (31) "Antibodies; Signal Transduction"
$value[0]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
⇄⧉search_terms => string (1122) "aaa25091 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affini...
$value[0]['_source']['search_terms']
aaa25091 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes ero1l species crossreactivity elisa eia immunohistochemistry ihc paraffin western blot wb p 1.5ug ml applications are based on unconjugated antibody detection against immunogen 35.9kd aaa25091_wb analysis of expression hela aaa25091_wb2 transfected 293t cell line lane 1 lysate 54kd 2 non aaa25091_wb3 immunoperoxidase to formalin fixed embedded small intestine concentration aaa25091_ihc4 testing data limit for recombinant gst tagged is ~3ng capture aaa25091_td5 pc 12 aaa25091_wb6 ero1 like alpha l endoplasmic oxidoreductin unq434 pro865 reticulum oxidoreductase ero1a ero1la ero1alpha 54.4 kda 468aa 7657069 np_055399 q96he7 nm_014584 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 af081886 mrna antibodies signal transduction partial corresponding aa90 179 from tag mw the alone 26kd sequence disqcgrrdcavkpcqsdevpdgiksasykyseeannlieeceqaerlgavdeslseetqkavlqwtkhddssdnfceaddiqspeaey conjugate ph7.2 lane1 54kd2 pc12 aa90179
⇄specificity => string (53) "Recognizes human ERO1L. Species Crossreactivity: rat."
$value[1]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[1]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[1]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[1]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[1]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 1.5ug/ml<br>Applications are based on unconjugated antibody."
$value[1]['_source']['app_notes']
⇄⧉testing_protocols => string (844) "WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L...
$value[1]['_source']['testing_protocols']
WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L expression in PC-12.||AAA25385_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ERO1L is ~3ng/ml as a capture antibody.||AAA25385_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].||AAA25385_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody. Lane 1: ERO1L transfected lysate (54kD). Lane 2: Non-transfected lysate.||AAA25385_WB3.jpg!!WB (Western Blot)||ERO1L monoclonal antibody, Western Blot analysis of ERO1L expression in HeLa.||AAA25385_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.9kD).||AAA25385_WB.jpg
⇄⧉etc_term1 => string (259) "Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (N...
$value[1]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY!!Conjugate||HRP
⇄⧉products_related_diseases => string (246) "Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!D...
$value[1]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!Diabetes Mellitus||3!!Lung Neoplasms||2!!Insulin Resistance||2!!Liver Neoplasms||1!!Glucose Intolerance||1!!Ischemia||1!!Drug-Related Side Effects and Adverse Reactions||1
⇄products_categories => string (31) "Antibodies; Signal Transduction"
$value[1]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
⇄⧉search_terms => string (1117) "aaa25385 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affini...
$value[1]['_source']['search_terms']
aaa25385 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes ero1l species crossreactivity elisa eia immunohistochemistry ihc paraffin western blot wb p 1.5ug ml applications are based on unconjugated antibody detection against immunogen 35.9kd aaa25385_wb analysis of expression hela aaa25385_wb2 transfected 293t cell line lane 1 lysate 54kd 2 non aaa25385_wb3 immunoperoxidase to formalin fixed embedded small intestine concentration aaa25385_ihc4 testing data limit for recombinant gst tagged is ~3ng capture aaa25385_td5 pc 12 aaa25385_wb6 ero1 like alpha l endoplasmic oxidoreductin unq434 pro865 reticulum oxidoreductase ero1a ero1la ero1alpha 54.4 kda 468aa 7657069 np_055399 q96he7 nm_014584 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 af081886 mrna antibodies signal transduction partial corresponding aa90 179 from tag mw the alone 26kd sequence disqcgrrdcavkpcqsdevpdgiksasykyseeannlieeceqaerlgavdeslseetqkavlqwtkhddssdnfceaddiqspeaey conjugate ph7.2 lane1 54kd2 pc12 aa90179
⇄⧉specificity => string (379) "This assay has high sensitivity and excellent specificity for detection of E...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of ERO1L. No significant cross-reactivity or interference between ERO1L and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between ERO1L and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||0.1 ng/mL
⇄etc_term2 => string (3) "N/A"
$value[2]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[2]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[2]['_source']['products_weight']
⇄products_status => boolean true
$value[2]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[2]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[2]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[2]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[2]['_source']['language_id']
⇄products_name => string (31) "ERO1 like protein Alpha (ERO1L)"
$value[2]['_source']['products_name']
⇄products_name_oem => string (47) "Human ERO1 like protein Alpha (ERO1L) ELISA Kit"
$value[2]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[2]['_source']['products_name_syn']
⇄products_gene_name => string (5) "ERO1L"
$value[2]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[2]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1402) "Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immun...
$value[2]['_source']['products_description']
Principle of the Assay: ERO1L ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-ERO1L antibody and an ERO1L-HRP conjugate. The assay sample and buffer are incubated together with ERO1L-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the ERO1L concentration since ERO1L from samples and ERO1L-HRP conjugate compete for the anti-ERO1L antibody binding site. Since the number of sites is limited, as more sites are occupied by ERO1L from the sample, fewer sites are left to bind ERO1L-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ERO1L concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This ERO1L ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human ERO1L. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!I...
$value[2]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Brain Diseases||3!!Nervous System Diseases||3!!Insulin Resistance||2!!Liver Diseases||2!!Glucose Intolerance||1!!Liver Neoplasms||1!!Atherosclerosis||1!!Ischemia||1!!Hyperglycemia||1
⇄products_categories => string (3) "N/A"
$value[2]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
$value[2]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (25) "ERO1-like (S. cerevisiae)"
⇄⧉search_terms => string (448) "aaa27336 human typical standard curve testing data aaa27336_td elisa kit ero...
$value[2]['_source']['search_terms']
aaa27336 human typical standard curve testing data aaa27336_td elisa kit ero1 like protein alpha ero1l s cerevisiae ero1a ero1la l oxidoreductin 1 endoplasmic 54,393 da unq434 pro865 ero1a_human 7657069 np_055399.1 q96he7 nm_014584.1 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 615435 samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive detection range 1.0 25ng ml sensitivity 0.1ng oxidoreductin1 range1.0
⇄specificity => string (53) "Recognizes human ERO1L. Species Crossreactivity: rat."
$value[3]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[3]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[3]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[3]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[3]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 1.5ug/ml<br>Applications are based on unconjugated antibody."
$value[3]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[3]['_source']['testing_protocols']
⇄⧉etc_term1 => string (258) "Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (N...
$value[3]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY!!Conjugate||AP
⇄⧉products_related_diseases => string (246) "Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!D...
$value[3]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!Diabetes Mellitus||3!!Lung Neoplasms||2!!Insulin Resistance||2!!Liver Neoplasms||1!!Glucose Intolerance||1!!Ischemia||1!!Drug-Related Side Effects and Adverse Reactions||1
⇄products_categories => string (31) "Antibodies; Signal Transduction"
$value[3]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
⇄⧉search_terms => string (1120) "aaa24203 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affini...
$value[3]['_source']['search_terms']
aaa24203 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes ero1l species crossreactivity elisa eia immunohistochemistry ihc paraffin western blot wb p 1.5ug ml applications are based on unconjugated antibody detection against immunogen 35.9kd mbs645170_wb analysis of expression hela mbs645170_wb2 transfected 293t cell line lane 1 lysate 54kd 2 non mbs645170_wb3 immunoperoxidase to formalin fixed embedded small intestine concentration mbs645170_ihc4 testing data limit for recombinant gst tagged is ~3ng capture mbs645170_td5 pc 12 mbs645170_wb6 ero1 like alpha l endoplasmic oxidoreductin unq434 pro865 reticulum oxidoreductase ero1a ero1la ero1alpha 54.4 kda 468aa 7657069 np_055399 q96he7 nm_014584 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 af081886 mrna antibodies signal transduction partial corresponding aa90 179 from tag mw the alone 26kd sequence disqcgrrdcavkpcqsdevpdgiksasykyseeannlieeceqaerlgavdeslseetqkavlqwtkhddssdnfceaddiqspeaey conjugate ph7.2 lane1 54kd2 pc12 aa90179
⇄specificity => string (53) "Recognizes human ERO1L. Species Crossreactivity: rat."
$value[4]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[4]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[4]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[4]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[4]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 1.5ug/ml<br>Applications are based on unconjugated antibody."
$value[4]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[4]['_source']['testing_protocols']
⇄⧉etc_term1 => string (259) "Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (N...
$value[4]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY!!Conjugate||APC
⇄⧉products_related_diseases => string (246) "Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!D...
$value[4]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!Diabetes Mellitus||3!!Lung Neoplasms||2!!Insulin Resistance||2!!Liver Neoplasms||1!!Glucose Intolerance||1!!Ischemia||1!!Drug-Related Side Effects and Adverse Reactions||1
⇄products_categories => string (31) "Antibodies; Signal Transduction"
$value[4]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
⇄⧉search_terms => string (1116) "aaa24499 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affini...
$value[4]['_source']['search_terms']
aaa24499 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes ero1l species crossreactivity elisa eia immunohistochemistry ihc paraffin western blot wb p 1.5ug ml applications are based on unconjugated antibody detection against immunogen 35.9kd mbs643795_wb analysis of expression hela mbs643795_wb2 transfected 293t cell line lane 1 lysate 54kd 2 non mbs643795_wb3 immunoperoxidase to formalin fixed embedded small intestine concentration mbs643795_ihc4 testing data limit for recombinant gst tagged is ~3ng capture mbs643795_td5 pc 12 mbs643795_wb6 ero1 like alpha l endoplasmic oxidoreductin unq434 pro865 reticulum oxidoreductase ero1a ero1la ero1alpha 54.4 kda 468aa 7657069 np_055399 q96he7 nm_014584 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 af081886 mrna antibodies signal transduction partial corresponding aa90 179 from tag mw the alone 26kd sequence disqcgrrdcavkpcqsdevpdgiksasykyseeannlieeceqaerlgavdeslseetqkavlqwtkhddssdnfceaddiqspeaey conjugate ph7.2 lane1 54kd2 pc12 aa90179
⇄specificity => string (53) "Recognizes human ERO1L. Species Crossreactivity: rat."
$value[5]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[5]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[5]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[5]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[5]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 1.5ug/ml<br>Applications are based on unconjugated antibody."
$value[5]['_source']['app_notes']
⇄⧉testing_protocols => string (844) "WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L...
$value[5]['_source']['testing_protocols']
WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L expression in PC-12.||AAA25680_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ERO1L is ~3ng/ml as a capture antibody.||AAA25680_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].||AAA25680_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody. Lane 1: ERO1L transfected lysate (54kD). Lane 2: Non-transfected lysate.||AAA25680_WB3.jpg!!WB (Western Blot)||ERO1L monoclonal antibody, Western Blot analysis of ERO1L expression in HeLa.||AAA25680_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.9kD).||AAA25680_WB.jpg
⇄⧉etc_term1 => string (258) "Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (N...
$value[5]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY!!Conjugate||PE
⇄⧉products_related_diseases => string (246) "Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!D...
$value[5]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!Diabetes Mellitus||3!!Lung Neoplasms||2!!Insulin Resistance||2!!Liver Neoplasms||1!!Glucose Intolerance||1!!Ischemia||1!!Drug-Related Side Effects and Adverse Reactions||1
⇄products_categories => string (31) "Antibodies; Signal Transduction"
$value[5]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
⇄⧉search_terms => string (1109) "aaa25680 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affini...
$value[5]['_source']['search_terms']
aaa25680 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes ero1l species crossreactivity elisa eia immunohistochemistry ihc paraffin western blot wb p 1.5ug ml applications are based on unconjugated antibody detection against immunogen 35.9kd aaa25680_wb analysis of expression hela aaa25680_wb2 transfected 293t cell line lane 1 lysate 54kd 2 non aaa25680_wb3 immunoperoxidase to formalin fixed embedded small intestine concentration aaa25680_ihc4 testing data limit for recombinant gst tagged is ~3ng capture aaa25680_td5 pc 12 aaa25680_wb6 ero1 like alpha l endoplasmic oxidoreductin unq434 pro865 reticulum oxidoreductase ero1a ero1la ero1alpha 54.4 kda 468aa 7657069 np_055399 q96he7 nm_014584 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 af081886 mrna antibodies signal transduction partial corresponding aa90 179 from tag mw the alone 26kd sequence disqcgrrdcavkpcqsdevpdgiksasykyseeannlieeceqaerlgavdeslseetqkavlqwtkhddssdnfceaddiqspeaey conjugate ph7.2 lane1 54kd2 pc12 aa90179
⇄specificity => string (53) "Recognizes human ERO1L. Species Crossreactivity: rat."
$value[6]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[6]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[6]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[6]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[6]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 1.5ug/ml<br>Applications are based on unconjugated antibody."
$value[6]['_source']['app_notes']
⇄⧉testing_protocols => string (844) "WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L...
$value[6]['_source']['testing_protocols']
WB (Western Blot)||ERO1L monoclonal antibody. Western Blot analysis of ERO1L expression in PC-12.||AAA24794_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ERO1L is ~3ng/ml as a capture antibody.||AAA24794_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].||AAA24794_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody. Lane 1: ERO1L transfected lysate (54kD). Lane 2: Non-transfected lysate.||AAA24794_WB3.jpg!!WB (Western Blot)||ERO1L monoclonal antibody, Western Blot analysis of ERO1L expression in HeLa.||AAA24794_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.9kD).||AAA24794_WB.jpg
⇄⧉etc_term1 => string (262) "Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (N...
$value[6]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY!!Conjugate||Biotin
⇄⧉products_related_diseases => string (246) "Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!D...
$value[6]['_source']['products_related_diseases']
Cardiovascular Diseases||4!!Liver Diseases||4!!Nervous System Diseases||3!!Diabetes Mellitus||3!!Lung Neoplasms||2!!Insulin Resistance||2!!Liver Neoplasms||1!!Glucose Intolerance||1!!Ischemia||1!!Drug-Related Side Effects and Adverse Reactions||1
⇄products_categories => string (31) "Antibodies; Signal Transduction"
$value[6]['_source']['products_categories']
⇄ncbi_full_name => string (23) "ERO1-like protein alpha"
⇄⧉search_terms => string (1097) "aaa24794 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affini...
$value[6]['_source']['search_terms']
aaa24794 mouse human rat monoclonal igg2b,k 4g3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes ero1l species crossreactivity elisa eia immunohistochemistry ihc paraffin western blot wb p 1.5ug ml applications are based on unconjugated antibody detection against immunogen 35.9kd aaa24794_wb analysis of expression hela aaa24794_wb2 transfected 293t cell line lane 1 lysate 54kd 2 non aaa24794_wb3 immunoperoxidase to formalin fixed embedded small intestine concentration aaa24794_ihc4 testing data limit for recombinant gst tagged is ~3ng capture aaa24794_td5 pc 12 aaa24794_wb6 ero1 like alpha l endoplasmic oxidoreductin unq434 pro865 reticulum oxidoreductase ero1a ero1la ero1alpha 54.4 kda 468aa 7657069 np_055399 q96he7 nm_014584 q7ld45 q9p1q9 q9ukv6 a8k9x4 a8myw1 af081886 mrna antibodies signal transduction partial corresponding aa90 179 from tag mw the alone 26kd sequence disqcgrrdcavkpcqsdevpdgiksasykyseeannlieeceqaerlgavdeslseetqkavlqwtkhddssdnfceaddiqspeaey conjugate ph7.2 lane1 54kd2 pc12 aa90179
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of P...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of PROS. No significant cross-reactivity or interference between PROS and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between PROS and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄storage_stability => string (34) "Store all reagents at 2-8 degree C"
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 pg/mL
⇄etc_term2 => string (3) "N/A"
$value[7]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[7]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[7]['_source']['products_weight']
⇄products_status => boolean true
$value[7]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[7]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[7]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[7]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[7]['_source']['language_id']
⇄products_name => string (9) "Protein S"
$value[7]['_source']['products_name']
⇄products_name_oem => string (25) "Mouse Protein S ELISA Kit"
$value[7]['_source']['products_name_oem']
⇄⧉products_name_syn => string (94) "Mouse Protein S (Protein S) ELISA Kit; Mouse Protein S ELISA Kit; Protein S;...
$value[7]['_source']['products_name_syn']
Mouse Protein S (Protein S) ELISA Kit; Mouse Protein S ELISA Kit; Protein S; Protein S (Mouse)
⇄products_gene_name => string (9) "Protein S"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1503) "Principle of the Assay: PROS ELISA kit applies the quantitative sandwich enz...
$value[7]['_source']['products_description']
Principle of the Assay: PROS ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for PROS. Standards or samples are then added to the microtiter plate wells and PROS if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of PROS present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for PROS are added to each well to "sandwich" the PROS immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain PROS and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The PROS concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This PROS ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse PROS. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (506) "aaa16417 mouse this assay has high sensitivity and excellent specificity for...
$value[7]['_source']['search_terms']
aaa16417 mouse this assay has high sensitivity and excellent specificity for detection of pros no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16417_sc elisa kit protein s 7717469 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative sandwich 1.0pg ml
⇄⧉products_description => string (830) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[8]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat PPAR-alpha monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (508) "aaa12430 rat typical testing data standard curve for reference only aaa12430...
$value[8]['_source']['search_terms']
aaa12430 rat typical testing data standard curve for reference only aaa12430_sc elisa kit peroxisome proliferator activated receptor alpha ppar a ppara nr1c1 hppar pparalpha nuclear subfamily 1 group c member proliferative variant 3 18,942 da ppara_human 765240 aab32649.1 q07869 q16241 q6i9s0 q92486 q92689 q9y3n1 b0g0x3 170998 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision subfamily1 variant3 range10
Samples||Human Serum And Cell Lysate!!Assay Type||Sandwich!!Sensitivity||6 ng/ml.
⇄⧉etc_term2 => string (252) "Intra-assay Precision||The low, medium, high spiked sample was tested four t...
$value[9]['_source']['etc_term2']
Intra-assay Precision||The low, medium, high spiked sample was tested four times on one plate to assess intra-assay precision!!Inter-assay Precision||The low, medium, high spiked sample was tested in four separate assays to assess inter-assay precision
⇄⧉products_description => string (1615) "Intended Uses: This GRS ELISA kit is to be used for the determination of Gly...
$value[9]['_source']['products_description']
Intended Uses: This GRS ELISA kit is to be used for the determination of Glycyl-tRNA synthetase (GRS) in human serum and cell lysate. This kits is intended for research use only!!Background/Introduction: GRS ELISA kit applies a technique called sandwich immunoassay. The microtiter plate provided in this kit has been pre-coated with a monoclonal antibody fragments specific for GRS. This GRS ELISA kit is to be used for the determination of GRS in human serum and cell lysate. As ancient proteins that arose as part of the development of the genetic code, aminoacyl-tRNA synthetases (ARSs) are essential components of the translation apparatus. The 20 enzymes, 1 for each amino acid, catalyze the attachment of each amino acid to its cognate tRNA in the cytoplasm, where the charged tRNAs are then used for ribosomal protein synthesis(1). Glycyl-tRNA synthetase (GRS) autoantibodies were detected in serum of subjects with cancer(2). In part because of our ongoing investigations of its novel functions, we focused on GRS. GRS can be secreted from macrophages in response to Fas ligand that is released from tumor cells. Through cadherin (CDH)6 (K-cadherin), GRS bound to different ERK-activated tumor cells, and released phosphatase 2A (PP2A) from CDH6. The activated PP2A then suppressed ERK signaling through dephosphorylation of ERK and induced apoptosis.With in vivo administration of GRS, growth of tumors with a high level of CDH6 and ERK activation were strongly suppressed. These observations led us to attempt to understand a potential role for GRS as a secreted protein in a cancer microenvironment (3).
⇄⧉search_terms => string (401) "aaa16013 human typical testing data standard curve for reference only aaa160...
$value[9]['_source']['search_terms']
aaa16013 human typical testing data standard curve for reference only aaa16013_sc elisa kit glucocorticoid receptor alpha a α gr nr3c1 64,824 da q865y6_bovin 38639409 q28023 q3huq5 q3t0x1 q865y6 samples serum and cell lysate assay type sandwich sensitivity 6 ng ml intra precision the low medium high spiked sample was tested four times on one plate to assess inter in separate assays sensitivity6
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of S...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SMAalpha. No significant cross-reactivity or interference between SMAalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SMAalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive or Sandwich!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 ng/mL
⇄⧉products_description => string (1543) "Principle of the Assay: SMAalpha ELISA kit applies the quantitative sandwich...
$value[10]['_source']['products_description']
Principle of the Assay: SMAalpha ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for SMAalpha. Standards or samples are then added to the microtiter plate wells and SMAalpha if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of SMAalpha present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for SMAalpha are added to each well to "sandwich" the SMAalpha immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain SMAalpha and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SMAalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SMAalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse SMAalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (767) "aaa16647 mouse this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa16647 mouse this assay has high sensitivity and excellent specificity for detection of smaalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16647_sc elisa kit alpha smooth muscle actin a sma aortic 2 aorta acta2 aat6 actsa mymy5 cardiac cell growth inhibiting gene 46 protein 42,009 da actvs gig46 acta_human 213688375 np_001135417.1 p62736 nm_001141945.1 p03996 p04108 q6fi19 b2r8a4 614042 signal transduction samples serum plasma culture supernatants body fluid tissue homogenate type quantitative sandwich 1.0 ng ml aortic2 gene46 sandwich1.0
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of S...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCalpha. No significant cross-reactivity or interference between SNCalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name_syn => string (28) "Canine a Synuclein ELISA Kit"
$value[11]['_source']['products_name_syn']
⇄products_gene_name => string (9) "alpha-SYN"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (5) "a-SYN"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1442) "Principle of the Assay: SNCalpha ELISA kit applies the competitive enzyme im...
$value[11]['_source']['products_description']
Principle of the Assay: SNCalpha ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-SNCalpha antibody and an SNCalpha-HRP conjugate. The assay sample and buffer are incubated together with SNCalpha-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the SNCalpha concentration since SNCalpha from samples and SNCalpha-HRP conjugate compete for the anti-SNCalpha antibody binding site. Since the number of sites is limited, as more sites are occupied by SNCalpha from the sample, fewer sites are left to bind SNCalpha-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SNCalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Canine SNCalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[11]['_source']['products_references']
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
⇄⧉sp_protein_name_syn => string (79) "Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; N...
$value[11]['_source']['sp_protein_name_syn']
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
⇄sp_gene_name => string (4) "Snca"
$value[11]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (9) "Syn; NACP"
$value[11]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "SYUA_MOUSE"
$value[11]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[11]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[11]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[11]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[11]['_source']['products_viewed']
⇄⧉search_terms => string (705) "aaa16913 canine this assay has high sensitivity and excellent specificity fo...
$value[11]['_source']['search_terms']
aaa16913 canine this assay has high sensitivity and excellent specificity for detection of sncalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16913_sc elisa kit alpha synuclein a syn snca nacp alphasyn non a4 component amyloid beta ad 12,345 da precursor syua_mouse 109638747 np_001035916.1 o55042 nm_001042451.2 q3u130 q9cxf8 q9eqc3 q9qur3 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml competitive1.0
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of T...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of TNF-alpha. No significant cross-reactivity or interference between TNF-alpha and analogues was observed.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[12]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉etc_term1 => string (152) "Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other b...
$value[12]['_source']['etc_term1']
Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||15.625-1000pg/ml!!Sensitivity||9.375pg/ml
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[12]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (479) "aaa17469 guinea pig this assay has high sensitivity and excellent specificit...
$value[12]['_source']['search_terms']
aaa17469 guinea pig this assay has high sensitivity and excellent specificity for detection of tnf alpha no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17469_sc elisa kit tumor necrosis factor a tnfa 83921651 np_001033074.1 nm_001037985.1 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 15.625 1000pg ml 9.375pg intra precision cv<8 inter cv<10
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||1-400ng/L!!Sensitivity||0.53ng/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[13]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (886) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[13]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Cat TNFA antibody. TNFA present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Cat TNFA Antibody is added and binds to TNFA in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated TNFA antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Cat TNFA. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Cat Tumor necrosis factor Alpha (also known as TNFA) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (571) "aaa19011 cat typical testing data standard curve for reference only aaa19011...
$value[13]['_source']['search_terms']
aaa19011 cat typical testing data standard curve for reference only aaa19011_sc elisa kit tumor necrosis factor alpha tnf dif tnfa tnfsf2 tnlg1f 25,644 da cachectin ligand superfamily member 2 a ntf icd1 icd2 37210 caa26669.1 p01375 o43647 q9p1q2 q9uiv3 samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 1ng l 400ng sensitivity 0.53ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 member2 x100
⇄⧉products_description => string (654) "Intended Uses: This ALPHA-GST ELISA kit is intended Laboratory for Research ...
$value[14]['_source']['products_description']
Intended Uses: This ALPHA-GST ELISA kit is intended Laboratory for Research use only. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of ALPHA-GST in the sample, this ALPHA-GST ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus ALPHA-GST concentration. The concentration of DYKDDDDK -TAG in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (165) "aaa23619 human typical testing data standard curve for reference only aaa236...
$value[14]['_source']['search_terms']
aaa23619 human typical testing data standard curve for reference only aaa23619_sc elisa kit glutathione s transferases alpha gst sensitivity 0.1 ng ml sensitivity0.1
⇄⧉specificity => string (397) "This assay has high sensitivity and excellent specificity for detection of H...
$value[15]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HSP-90alpha. No significant cross-reactivity or interference between HSP-90alpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between HSP-90alpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1480) "Principle of the Assay: HSP-90alpha ELISA kit applies the competitive enzyme...
$value[15]['_source']['products_description']
Principle of the Assay: HSP-90alpha ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-HSP-90alpha antibody and an HSP-90alpha-HRP conjugate. The assay sample and buffer are incubated together with HSP-90alpha-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the HSP-90alpha concentration since HSP-90alpha from samples and HSP-90alpha-HRP conjugate compete for the anti-HSP-90alpha antibody binding site. Since the number of sites is limited, as more sites are occupied by HSP-90alpha from the sample, fewer sites are left to bind HSP-90alpha-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HSP-90alpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This HSP-90alpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse HSP-90alpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (229) "Nervous System Diseases||7!!Carcinoma, Hepatocellular||3!!Cardiovascular Dis...
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||5-1000ng/L!!Sensitivity||2.51ng/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[16]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (886) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[16]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Rat TNFA antibody. TNFA present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Rat TNFA Antibody is added and binds to TNFA in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated TNFA antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Rat TNFA. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Rat Tumor necrosis factor Alpha (also known as TNFA) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (437) "aaa11175 rat typical testing data standard curve for reference only aaa11175...
$value[16]['_source']['search_terms']
aaa11175 rat typical testing data standard curve for reference only aaa11175_sc elisa kit tumor necrosis factor alpha tnf dif tnfa tnfsf2 tnlg1f 25,644 da cachectin ligand superfamily member 2 a ntf icd1 icd2 37210 caa26669.1 p01375 o43647 q9p1q2 q9uiv3 samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 5ng l 1000ng sensitivity 2.51ng intra cv<8 inter cv<10 member2
Assay Type||Competitive!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||5-1000ng/L!!Sensitivity||3.08ng/L
⇄⧉etc_term2 => string (406) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[17]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV< 10%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV< 12%
⇄⧉products_description => string (1028) "Principle of the Assay: This kit is a Enzyme-Linked Immunosorbent Assay (ELI...
$value[17]['_source']['products_description']
Principle of the Assay: This kit is a Enzyme-Linked Immunosorbent Assay (ELISA). Add samples to the pre-coated plate. Then add biotinylated antigen. The antigens in the samples compete with the biotinylated antigen to bind to the capture antibody and incubate. Unbound antigen is washed away during a washing step. An avidin-HRP is then added and then incubate. Unbound avidin-HRP is washed away during a washing step. TMB Substrate is then added and color develops. The reaction is stopped by addition of acidic stop solution and color changes into yellow that can be measured at 450 nm. The intensity of the color developed is inversely proportional to the concentration of IFNA in the sample. The concentration of IFNA in the sample is then determined by comparing the O.D. of the samples to the standard curve.<br><br>Intended Uses: This competitive ELISA kit is for the quantification of Interferon Alpha(also known as IFNA) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of R...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of Rat TNF-alpha. No significant cross-reactivity or interference between Rat TNF-alpha and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄storage_stability => string (22) "Store at 2-8 degree C."
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||6.25 pg/mL - 400 pg/mL!!Sensitivity||3.1 pg/mL (mean of 6 independent assays)
⇄⧉etc_term2 => string (422) "Intra-assay Precision||Intra-assay Precision (Precision within an assay) Thr...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay) Three samples of known concentration were tested twenty times on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-assay Precision (Precision between assays) Three samples of known concentration were tested in forty separate assays to assess inter-assay precision. CV (%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (976) "Principle of the Assay: This assay employs a two-site sandwich ELISA to quan...
$value[18]['_source']['products_description']
Principle of the Assay: This assay employs a two-site sandwich ELISA to quantitate TNF-alpha in Rat serum, plasma, tissue homogenates. An antibody specific for TNF-alpha has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TNF-alpha present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TNF-alpha is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TNF-alpha bound in the initial step. The color development is stopped and the intensity of the color is measured.<br><br>Intended Uses: For the quantitative detection of Rat Tumor necrosis factor alpha (TNF-alpha) concentration in serum, plasma, tissue homogenates and other biological fluids.
⇄⧉search_terms => string (597) "aaa13249 rat this assay has high sensitivity and excellent specificity for d...
$value[18]['_source']['search_terms']
aaa13249 rat this assay has high sensitivity and excellent specificity for detection of tnf alpha no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa13249_td elisa kit tumor necrosis factor tnfa 189409065 np_001121579.1 nm_001128107.1 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 6.25 pg ml 400 3.1 intra precision within an three known concentration were tested twenty times on one plate to assess cv<8 inter assays in forty separate cv = sd meanx100 cv<12 ml400
⇄⧉products_description => string (829) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[19]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat alpha-SMA monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (496) "aaa12916 rat typical testing data standard curve for reference only aaa12916...
$value[19]['_source']['search_terms']
aaa12916 rat typical testing data standard curve for reference only aaa12916_sc elisa kit alpha smooth muscle actin sma a gamma enteric isoform 1 2 actg2 act acte vscm acta3 actl3 actsg 3 like protein 37,083 da acth_human 4501889 np_001606.1 p63267 nm_001615.3 p12718 q504r1 q6fi22 b2r7e7 b4e315 d6w5h8 e9pg30 102545 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 50 ng ml 0.78 sensitivity up to 0.1 intra precision isoform1 actsg3 range50 to0.1
