Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 10ug 293(Trex)FlpIn-RIPK1-HA-Strep (-Doxycycline)-non inducedLane 2: 10ug 293(Trex)FlpIn-RIPK1-HA-Strep (+Doxycycline)-inducedPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:RIPK1Submitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer Research)

Rabbit RIPK1 Polyclonal Antibody | anti-RIPK1 antibody

RIPK1 antibody - middle region

Gene Names
RIPK1; RIP; RIP1; IMD57; RIP-1
Reactivity
Cow, Dog, Horse, Human
Applications
Western Blot
Synonyms
RIPK1; Polyclonal Antibody; RIPK1 antibody - middle region; anti-RIPK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ
Sequence Length
671
Applicable Applications for anti-RIPK1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 91%; Horse: 83%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RIPK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 10ug 293(Trex)FlpIn-RIPK1-HA-Strep (-Doxycycline)-non inducedLane 2: 10ug 293(Trex)FlpIn-RIPK1-HA-Strep (+Doxycycline)-inducedPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:RIPK1Submitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer Research)

Western Blot (WB) (Lanes:Lane 1: 10ug 293(Trex)FlpIn-RIPK1-HA-Strep (-Doxycycline)-non inducedLane 2: 10ug 293(Trex)FlpIn-RIPK1-HA-Strep (+Doxycycline)-inducedPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:RIPK1Submitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer Research)

Western Blot (WB)

(WB Suggested Anti-RIPK1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-RIPK1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-RIPK1 antibody
This is a rabbit polyclonal antibody against RIPK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FAK overexpression in human tumors provides a survival signal function by binding to RIP and inhibiting its interaction with the death receptor complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 1 isoform 1
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 1
NCBI Official Symbol
RIPK1
NCBI Official Synonym Symbols
RIP; RIP1; IMD57; RIP-1
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 1
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 1
UniProt Gene Name
RIPK1
UniProt Synonym Gene Names
RIP; RIP1; RIP-1
UniProt Entry Name
RIPK1_HUMAN

NCBI Description

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of developmental regulation. RIPK1/RIPK3 kinase-mediated necrosis is referred to as necroptosis. Genetic disruption of this gene in mice results in death shortly after birth. [provided by RefSeq, Aug 2017]

Uniprot Description

RIPK1: Serine-threonine kinase which transduces inflammatory and cell-death signals (necroptosis) following death receptors ligation, activation of pathogen recognition receptors (PRRs), and DNA damage. Upon activation of TNFR1 by the TNF-alpha family cytokines, TRADD and TRAF2 are recruited to the receptor. Ubiquitination by TRAF2 via 'Lys-63'-link chains acts as a critical enhancer of communication with downstream signal transducers in the mitogen-activated protein kinase pathway and the NF-kappa-B pathway, which in turn mediate downstream events including the activation of genes encoding inflammatory molecules. Polyubiquitinated protein binds to IKBKG/NEMO, the regulatory subunit of the IKK complex, a critical event for NF-kappa-B activation. Interaction with other cellular RHIM-containing adapters initiates gene activation and cell death. RIPK1 and RIPK3 association, in particular, forms a necroptosis-inducing complex. Interacts (via RIP homotypic interaction motif) with RIPK3 (via RIP homotypic interaction motif); this interaction induces RIPK1 necroptosis-specific phosphorylation, formation of the necroptosis-inducing complex. Interacts (via the death domain) with TNFRSF6 (via the death domain) and TRADD (via the death domain). Is recruited by TRADD to TNFRSF1A in a TNF-dependent process. Binds RNF216, EGFR, IKBKG, TRAF1, TRAF2 and TRAF3. Interacts with BNLF1. Interacts with SQSTM1 upon TNF-alpha stimulation. May interact with MAVS/IPS1. Interacts with ZFAND5. Interacts with RBCK1. Interacts with BIRC2/c-IAP1, BIRC3/c-IAP2 and XIAP/BIRC4. Inhibited by necrostatin-1. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Protein kinase, TKL; TKL group; RIPK family

Chromosomal Location of Human Ortholog: 6p25.2

Cellular Component: mitochondrion; cytoplasm; cytosol; receptor complex; lipid raft

Molecular Function: identical protein binding; protein serine/threonine kinase activity; protein binding; ubiquitin protein ligase binding; death receptor binding; protein complex binding; ATP binding; protein kinase activity

Biological Process: caspase activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein heterooligomerization; positive regulation of apoptosis; apoptosis; MyD88-independent toll-like receptor signaling pathway; protein amino acid autophosphorylation; positive regulation of JNK cascade; negative regulation of I-kappaB kinase/NF-kappaB cascade; toll-like receptor 3 signaling pathway; positive regulation of tumor necrosis factor production; activation of JNK activity; activation of NF-kappaB transcription factor; positive regulation of interleukin-8 production; positive regulation of programmed cell death; tumor necrosis factor-mediated signaling pathway; cellular protein catabolic process; toll-like receptor signaling pathway; positive regulation of interferon type I production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; positive regulation of macrophage differentiation; toll-like receptor 4 signaling pathway; protein homooligomerization

Research Articles on RIPK1

Similar Products

Product Notes

The RIPK1 ripk1 (Catalog #AAA3224349) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK1 antibody - middle region reacts with Cow, Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIPK1 ripk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRRRVSHDPF AQQRPYENFQ NTEGKGTAYS SAASHGNAVH QPSGLTSQPQ. It is sometimes possible for the material contained within the vial of "RIPK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.