Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human PDE3A Monoclonal Antibody | anti-PDE3A antibody

PDE3A (cGMP-inhibited 3',5'-cyclic Phosphodiesterase A, Cyclic GMP-inhibited Phosphodiesterase A, CGI-PDE A) (FITC)

Gene Names
PDE3A; HTNB; CGI-PDE; CGI-PDE A; CGI-PDE-A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDE3A; Monoclonal Antibody; PDE3A (cGMP-inhibited 3'; 5'-cyclic Phosphodiesterase A; Cyclic GMP-inhibited Phosphodiesterase A; CGI-PDE A) (FITC); anti-PDE3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C12
Specificity
Recognizes human PDE3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PDE3A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa533-640 from human PDE3A (NP_000912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Testing Data

(Detection limit for 131047 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for 131047 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-PDE3A antibody
Phosphodiesterase 3A is a cGMP inhibited, cAMP/cGMP dual-specific phosphodiesterase. PDE3A has been implicated in male erectile dysfunction, mammalian oocyte maturation, platelet function, vascular smooth muscle function, and salivary gland tumors. Three alternatively spliced transcripts have been reported.
Product Categories/Family for anti-PDE3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124,979 Da
NCBI Official Full Name
cGMP-inhibited 3',5'-cyclic phosphodiesterase A isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 3A, cGMP-inhibited
NCBI Official Symbol
PDE3A
NCBI Official Synonym Symbols
HTNB; CGI-PDE; CGI-PDE A; CGI-PDE-A
NCBI Protein Information
cGMP-inhibited 3',5'-cyclic phosphodiesterase A
UniProt Protein Name
cGMP-inhibited 3',5'-cyclic phosphodiesterase A
UniProt Gene Name
PDE3A
UniProt Entry Name
PDE3A_HUMAN

NCBI Description

This gene encodes a member of the cGMP-inhibited cyclic nucleotide phosphodiesterase (cGI-PDE) family. cGI-PDE enzymes hydrolyze both cAMP and cGMP, and play critical roles in many cellular processes by regulating the amplitude and duration of intracellular cyclic nucleotide signals. The encoded protein mediates platelet aggregation and also plays important roles in cardiovascular function by regulating vascular smooth muscle contraction and relaxation. Inhibitors of the encoded protein may be effective in treating congestive heart failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]

Research Articles on PDE3A

Similar Products

Product Notes

The PDE3A pde3a (Catalog #AAA6148757) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDE3A (cGMP-inhibited 3',5'-cyclic Phosphodiesterase A, Cyclic GMP-inhibited Phosphodiesterase A, CGI-PDE A) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE3A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDE3A pde3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDE3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.