Western Blot (WB)
(WB Suggested Anti-LHPP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Rabbit LHPP Polyclonal Antibody | anti-LHPP antibody
LHPP antibody - middle region
Gene Names
LHPP; HDHD2B
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LHPP; Polyclonal Antibody; LHPP antibody - middle region; anti-LHPP antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Sequence Length
270
Applicable Applications for anti-LHPP antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 83%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LHPP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LHPP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Western Blot (WB)
(WB Suggested Anti-LHPP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Related Product Information for anti-LHPP antibody
This is a rabbit polyclonal antibody against LHPP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-LHPP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
phospholysine phosphohistidine inorganic pyrophosphate phosphatase isoform 1
NCBI Official Synonym Full Names
phospholysine phosphohistidine inorganic pyrophosphate phosphatase
NCBI Official Symbol
LHPP
NCBI Official Synonym Symbols
HDHD2B
NCBI Protein Information
phospholysine phosphohistidine inorganic pyrophosphate phosphatase
UniProt Protein Name
Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
UniProt Gene Name
LHPP
UniProt Synonym Gene Names
hLHPP
UniProt Entry Name
LHPP_HUMAN
Uniprot Description
LHPP: Phosphatase that hydrolyzes imidodiphosphate, 3- phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency. Belongs to the HAD-like hydrolase superfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Energy Metabolism - oxidative phosphorylation; Mitochondrial; Hydrolase; EC 3.6.1.1
Chromosomal Location of Human Ortholog: 10q26.13
Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol
Molecular Function: inorganic diphosphatase activity; protein homodimerization activity; magnesium ion binding; phosphohistidine phosphatase activity
Biological Process: protein amino acid dephosphorylation; phosphate metabolic process
Research Articles on LHPP
Similar Products
Product Notes
The LHPP lhpp (Catalog #AAA3213449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHPP antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LHPP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LHPP lhpp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACGIKAEVVG KPSPEFFKSA LQAIGVEAHQ AVMIGDDIVG DVGGAQRCGM. It is sometimes possible for the material contained within the vial of "LHPP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
