Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL6RASample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse IL6RA Polyclonal Antibody | anti-IL6RA antibody

IL6RA Antibody - C-terminal region

Gene Names
Il6ra; Il6r; CD126; IL-6R; IL-6RA; IL-6R-alpha
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
IL6RA; Polyclonal Antibody; IL6RA Antibody - C-terminal region; anti-IL6RA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDY
Sequence Length
460
Applicable Applications for anti-IL6RA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse IL6RA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL6RASample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL6RASample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IL6RA antibody
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Product Categories/Family for anti-IL6RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
interleukin-6 receptor subunit alpha isoform 1
NCBI Official Synonym Full Names
interleukin 6 receptor, alpha
NCBI Official Symbol
Il6ra
NCBI Official Synonym Symbols
Il6r; CD126; IL-6R; IL-6RA; IL-6R-alpha
NCBI Protein Information
interleukin-6 receptor subunit alpha
UniProt Protein Name
Interleukin-6 receptor subunit alpha
UniProt Gene Name
Il6ra
UniProt Synonym Gene Names
Il6r; IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA
UniProt Entry Name
IL6RA_MOUSE

Uniprot Description

IL6R: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis. Belongs to the type I cytokine receptor family. Type 3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Cellular Component: apical plasma membrane; cell surface; extracellular region; extracellular space; integral to membrane; interleukin-6 receptor complex; membrane

Molecular Function: ciliary neurotrophic factor receptor activity; enzyme binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-6 binding; interleukin-6 receptor activity; interleukin-6 receptor binding; protein homodimerization activity

Biological Process: cell growth; cytokine and chemokine mediated signaling pathway; developmental growth; endocrine pancreas development; negative regulation of collagen biosynthetic process; positive regulation of cell proliferation; positive regulation of chemokine production; positive regulation of interleukin-6 production; positive regulation of JAK-STAT cascade; positive regulation of MAPKKK cascade; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of smooth muscle cell proliferation; positive regulation of tyrosine phosphorylation of Stat3 protein; response to cytokine stimulus

Research Articles on IL6RA

Similar Products

Product Notes

The IL6RA il6ra (Catalog #AAA3224275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL6RA Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IL6RA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL6RA il6ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPYSLGPLKP TFLLVPLLTP HSSGSDNTVN HSCLGVRDAQ SPYDNSNRDY. It is sometimes possible for the material contained within the vial of "IL6RA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.