Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KCNIP3Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KCNIP3 Polyclonal Antibody | anti-KCNIP3 antibody

KCNIP3 Antibody - N-terminal region

Gene Names
KCNIP3; CSEN; DREAM; KCHIP3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNIP3; Polyclonal Antibody; KCNIP3 Antibody - N-terminal region; anti-KCNIP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSD
Sequence Length
256
Applicable Applications for anti-KCNIP3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KCNIP3Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KCNIP3Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KCNIP3 antibody
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
calsenilin isoform 2
NCBI Official Synonym Full Names
potassium voltage-gated channel interacting protein 3
NCBI Official Symbol
KCNIP3
NCBI Official Synonym Symbols
CSEN; DREAM; KCHIP3
NCBI Protein Information
calsenilin
UniProt Protein Name
Calsenilin
Protein Family
UniProt Gene Name
KCNIP3
UniProt Synonym Gene Names
CSEN; DREAM; KCHIP3; DREAM; KChIP3
UniProt Entry Name
CSEN_HUMAN

NCBI Description

This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

calsenilin: a small calcium-binding protein. Member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Modulates K4 voltage-gated potassium channels. May regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Also functions as a calcium-regulated transcriptional repressor, and to interact with presenilins. May play a role in the regulation of PSEN2 proteolytic processing.

Protein type: Calcium-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2q21.1

Cellular Component: Golgi apparatus; voltage-gated potassium channel complex; endoplasmic reticulum; dendrite; nerve terminal; nucleus; cytosol

Molecular Function: protein C-terminus binding; potassium channel regulator activity; DNA binding; potassium channel activity; sequence-specific DNA binding; voltage-gated ion channel activity; calcium ion binding; transcription corepressor activity; calcium-dependent protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; intracellular protein transport; behavioral response to pain; transcription, DNA-dependent; apoptosis; regulation of neuron apoptosis; negative regulation of transcription from RNA polymerase II promoter; sensory perception of pain; signal transduction

Research Articles on KCNIP3

Similar Products

Product Notes

The KCNIP3 kcnip3 (Catalog #AAA3223480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNIP3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNIP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNIP3 kcnip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGDLGHTPL SKKEGIKWQR PRLSRQALMR CCLVKWILSS TAPQGSDSSD. It is sometimes possible for the material contained within the vial of "KCNIP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.