Rabbit anti-Human STEAP1 Polyclonal Antibody | anti-STEAP1 antibody

STEAP1 Antibody - N-terminal region

Cat. Num. AAA3220625

• Gene Names: STEAP1; STEAP; PRSS24
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: STEAP1; Polyclonal Antibody; STEAP1 Antibody - N-terminal region; anti-STEAP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADE
• Sequence Length: 167

• Applicable Applications for anti-STEAP1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STEAP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STEAP1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-STEAP1 antibody

This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.

Product Categories/Family for anti-STEAP1 antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 9558759
• NCBI GeneID: 26872
• NCBI Accession #: NP_036581.1
• NCBI GenBank Nucleotide #: NM_012449.2
• UniProt Accession #: Q9UHE8
• Molecular Weight: 40 kDa
• NCBI Official Full Name: metalloreductase STEAP1
• NCBI Official Synonym Full Names: STEAP family member 1
• NCBI Official Symbol: STEAP1
• NCBI Official Synonym Symbols: STEAP; PRSS24
• NCBI Protein Information: metalloreductase STEAP1
• UniProt Protein Name: Metalloreductase STEAP1
• Protein Family: Metalloreductase
• UniProt Gene Name: STEAP1
• UniProt Synonym Gene Names: PRSS24; STEAP
• UniProt Entry Name: STEA1_HUMAN

NCBI Description

This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008]

Uniprot Description

STEAP1: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Belongs to the STEAP family.

Protein type: Cell adhesion; EC 1.16.1.-; Membrane protein, multi-pass; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: membrane; integral to plasma membrane; plasma membrane; endosome membrane; intercellular junction

Molecular Function: transporter activity; channel activity; metal ion binding; oxidoreductase activity

Biological Process: iron ion homeostasis; ion transport; transmembrane transport