Mouse anti-Human GRM6 Monoclonal Antibody | anti-GRM6 antibody

GRM6 (GRM6, GPRC1F, MGLUR6, Metabotropic Glutamate Receptor 6) (AP)

Cat. Num. AAA6131567

• Gene Names: GRM6; mGlu6; CSNB1B; GPRC1F; MGLUR6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GRM6; Monoclonal Antibody; GRM6 (GRM6; GPRC1F; MGLUR6; Metabotropic Glutamate Receptor 6) (AP); anti-GRM6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A11
• Specificity: Recognizes human GRM6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GRM6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa477-566 from human GRM6 (NP_000834) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHCEACDGYRFQVDEFTCEACPGDMRPTP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(GRM6 monoclonal antibody. Western Blot analysis of GRM6 expression in human spleen.)

Related Product Information for anti-GRM6 antibody

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.

Product Categories/Family for anti-GRM6 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 110611176
• NCBI GeneID: 2916
• NCBI Accession #: NP_000834
• NCBI GenBank Nucleotide #: NM_000843
• UniProt Accession #: O15303
• Molecular Weight: 95,468 Da
• NCBI Official Full Name: metabotropic glutamate receptor 6
• NCBI Official Synonym Full Names: glutamate receptor, metabotropic 6
• NCBI Official Symbol: GRM6
• NCBI Official Synonym Symbols: mGlu6; CSNB1B; GPRC1F; MGLUR6
• NCBI Protein Information: metabotropic glutamate receptor 6
• UniProt Protein Name: Metabotropic glutamate receptor 6
• Protein Family: Metabotropic glutamate receptor
• UniProt Gene Name: GRM6
• UniProt Synonym Gene Names: GPRC1F; MGLUR6; mGluR6
• UniProt Entry Name: GRM6_HUMAN

Uniprot Description

mGluR6: Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. Defects in GRM6 are the cause of congenital stationary night blindness type 1B (CSNB1B). This disorder consits of a previously unrecognized, autosomal recessive form of congenital night blindness associated with a negative electroretinogram waveform. Patients are night blind from an early age, and when maximally dark-adapted, they could perceive lights only with an intensity equal to or slightly dimmer than that normally detected by the cone system. ERGs in response to single brief flashes of light have clearly detectable a-waves, which are derived from photoreceptors, and greatly reduced b-waves, which are derived from the second-order inner retinal neurons. ERGs in response to sawtooth flickering light indicate a markedly reduced ON response and a nearly normal OFF response. There is no subjective delay in the perception of suddenly appearing white vs black objects on a gray background. Belongs to the G-protein coupled receptor 3 family.

Protein type: Receptor, GPCR; GPCR, family 3; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: presynaptic membrane; Golgi membrane; endoplasmic reticulum membrane; integral to plasma membrane; dendrite; plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; group III metabotropic glutamate receptor activity; protein homodimerization activity; glutamate receptor activity

Biological Process: synaptic transmission; regulation of synaptic transmission, glutamatergic; retina development in camera-type eye; metabotropic glutamate receptor signaling pathway; detection of light stimulus involved in visual perception; locomotory behavior; metabotropic glutamate receptor, adenylate cyclase inhibiting pathway; detection of visible light

Disease: Night Blindness, Congenital Stationary, Type 1b