Metalloreductase STEAP1 (STEAP1) Recombinant Protein | STEAP1 recombinant protein

Recombinant Human Metalloreductase STEAP1 (STEAP1)

Cat. Num. AAA7030584

• Gene Names: STEAP1; STEAP; PRSS24
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Metalloreductase STEAP1 (STEAP1); Recombinant Human Metalloreductase STEAP1 (STEAP1); STEAP1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-339aa; Full Length
• Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

Related Product Information for STEAP1 recombinant protein

Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor

Product Categories/Family for STEAP1 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 9558759
• NCBI GeneID: 26872
• NCBI Accession #: NP_036581.1
• NCBI GenBank Nucleotide #: NM_012449.2
• UniProt Accession #: Q9UHE8; O95034; A4D1E0
• Molecular Weight: 58.4 kDa
• NCBI Official Full Name: metalloreductase STEAP1
• NCBI Official Synonym Full Names: six transmembrane epithelial antigen of the prostate 1
• NCBI Official Symbol: STEAP1
• NCBI Official Synonym Symbols: STEAP; PRSS24
• NCBI Protein Information: metalloreductase STEAP1
• UniProt Protein Name: Metalloreductase STEAP1
• Protein Family: Metalloreductase
• UniProt Gene Name: STEAP1
• UniProt Synonym Gene Names: PRSS24; STEAP
• UniProt Entry Name: STEA1_HUMAN

NCBI Description

This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008]

Uniprot Description

STEAP1: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Belongs to the STEAP family.

Protein type: Membrane protein, integral; Cell adhesion; Membrane protein, multi-pass; EC 1.16.1.-; Oxidoreductase

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: endosome; endosome membrane; integral to plasma membrane; intercellular junction; membrane; plasma membrane

Molecular Function: channel activity; cupric reductase activity; metal ion binding; transporter activity

Biological Process: copper ion import; iron ion homeostasis; transmembrane transport