Metalloreductase STEAP1 Recombinant Protein | STEAP1 recombinant protein

Recombinant Human Metalloreductase STEAP1

Cat. Num. AAA969772

• Gene Names: STEAP1; STEAP; PRSS24
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Metalloreductase STEAP1; Recombinant Human Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1; STEAP1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 3-69aa; Partial
• Sequence: SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for STEAP1 recombinant protein

Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor.

Product Categories/Family for STEAP1 recombinant protein

Transport

References

STEAP a prostate-specific cell-surface antigen highly expressed in human prostate tumors.Hubert R.S., Vivanco I., Chen E., Rastegar S., Leong K., Mitchell S.C., Madraswala R., Zhou Y., Kuo J., Raitano A.B., Jakobovits A., Saffran D.C., Afar D.E.H.Proc. Natl. Acad. Sci. U.S.A. 96:14523-14528(1999) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003) The Steap proteins are metalloreductases.Ohgami R.S., Campagna D.R., McDonald A., Fleming M.D.Blood 108:1388-1394(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 9558759
• NCBI GeneID: 26872
• NCBI Accession #: NP_036581.1
• NCBI GenBank Nucleotide #: NM_012449.2
• UniProt Accession #: Q9UHE8; O95034; A4D1E0
• Molecular Weight: 35 kDa
• NCBI Official Full Name: metalloreductase STEAP1
• NCBI Official Synonym Full Names: six transmembrane epithelial antigen of the prostate 1
• NCBI Official Symbol: STEAP1
• NCBI Official Synonym Symbols: STEAP; PRSS24
• NCBI Protein Information: metalloreductase STEAP1
• UniProt Protein Name: Metalloreductase STEAP1
• Protein Family: Metalloreductase
• UniProt Gene Name: STEAP1
• UniProt Synonym Gene Names: PRSS24; STEAP
• UniProt Entry Name: STEA1_HUMAN

NCBI Description

This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008]

Uniprot Description

STEAP1: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Belongs to the STEAP family.

Protein type: Oxidoreductase; EC 1.16.1.-; Membrane protein, multi-pass; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: endosome membrane; integral to plasma membrane; intercellular junction; membrane; plasma membrane

Molecular Function: channel activity; cupric reductase activity; metal ion binding; transporter activity

Biological Process: copper ion import; iron ion homeostasis; transmembrane transport