Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-INAR2 antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Rabbit anti-Human IFNAR2 Polyclonal Antibody | anti-IFNAR2 antibody

IFNAR2 Antibody - C-terminal region

Gene Names
IFNAR2; IFN-R; IMD45; IFNABR; IFNARB; IFN-alpha-REC
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IFNAR2; Polyclonal Antibody; IFNAR2 Antibody - C-terminal region; anti-IFNAR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPRTSGGGYTM
Sequence Length
515
Applicable Applications for anti-IFNAR2 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-IFNAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human INAR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-INAR2 antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Western Blot (WB) (WB Suggested Anti-INAR2 antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)
Related Product Information for anti-IFNAR2 antibody
This is a rabbit polyclonal antibody against INAR2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. Multiple transcript variants encoding at least two different isoforms have been found for this gene.
Product Categories/Family for anti-IFNAR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56 kDa
NCBI Official Full Name
interferon alpha/beta receptor 2 isoform a
NCBI Official Synonym Full Names
interferon alpha and beta receptor subunit 2
NCBI Official Symbol
IFNAR2
NCBI Official Synonym Symbols
IFN-R; IMD45; IFNABR; IFNARB; IFN-alpha-REC
NCBI Protein Information
interferon alpha/beta receptor 2
UniProt Protein Name
Interferon alpha/beta receptor 2
UniProt Gene Name
IFNAR2
UniProt Synonym Gene Names
IFNABR; IFNARB; IFN-R-2; IFN-alpha binding protein; IFN-alpha/beta receptor 2
UniProt Entry Name
INAR2_HUMAN

NCBI Description

The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. Multiple transcript variants encoding at least two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

IFNAR2: Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity. Belongs to the type II cytokine receptor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: protein binding; interferon-alpha/beta receptor activity; interferon-alpha/beta binding; protein kinase binding

Biological Process: regulation of transcription from RNA polymerase II promoter; cell proliferation; cell surface receptor linked signal transduction; cytokine and chemokine mediated signaling pathway; response to virus; JAK-STAT cascade

Disease: Hepatitis B Virus, Susceptibility To

Research Articles on IFNAR2

Similar Products

Product Notes

The IFNAR2 ifnar2 (Catalog #AAA3220302) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNAR2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNAR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFNAR2 ifnar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPNLPPLEAM DMVEVIYINR KKKVWDYNYD DESDSDTEAA PRTSGGGYTM. It is sometimes possible for the material contained within the vial of "IFNAR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.