Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BEAN1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlBEAN1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human BEAN1 Polyclonal Antibody | anti-BEAN1 antibody

BEAN1 Antibody - C-terminal region

Gene Names
BEAN1; BEAN; SCA31
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BEAN1; Polyclonal Antibody; BEAN1 Antibody - C-terminal region; anti-BEAN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDT
Sequence Length
259
Applicable Applications for anti-BEAN1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BEAN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BEAN1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlBEAN1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: BEAN1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlBEAN1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-BEAN1 antibody
This is a rabbit polyclonal antibody against BEAN1. It was validated on Western Blot

Target Description: The protein encoded by this gene is one of several proteins that interact with NEDD4, a member of a family of ubiquitin-protein ligases. These proteins have PY motifs in common that bind to the WW domains of NEDD4. NEDD4 is developmentally regulated, and is highly expressed in embryonic tissues. Mutations in this gene (i.e., intronic insertions of >100 copies of pentanucleotide repeats including a (TGGAA)n sequence) are associated with spinocerebellar ataxia type 31. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-BEAN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
protein BEAN1 isoform 1
NCBI Official Synonym Full Names
brain expressed associated with NEDD4 1
NCBI Official Symbol
BEAN1
NCBI Official Synonym Symbols
BEAN; SCA31
NCBI Protein Information
protein BEAN1
UniProt Protein Name
Protein BEAN1
Protein Family
UniProt Gene Name
BEAN1
UniProt Synonym Gene Names
BEAN
UniProt Entry Name
BEAN1_HUMAN

NCBI Description

The protein encoded by this gene is one of several proteins that interact with NEDD4, a member of a family of ubiquitin-protein ligases. These proteins have PY motifs in common that bind to the WW domains of NEDD4. NEDD4 is developmentally regulated, and is highly expressed in embryonic tissues. Mutations in this gene (i.e., intronic insertions of >100 copies of pentanucleotide repeats including a (TGGAA)n sequence) are associated with spinocerebellar ataxia type 31. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]

Uniprot Description

BEAN: Defects in BEAN1 are the cause of spinocerebellar ataxia type 31 (SCA31); also known as spinocerebellar ataxia 16q22-linked. A form of spinocerebellar ataxia, a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA31 belongs to the autosomal dominant cerebellar ataxias type III (ADCA III) which are characterized by pure cerebellar ataxia without additional signs. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: integral to membrane

Disease: Spinocerebellar Ataxia 31

Research Articles on BEAN1

Similar Products

Product Notes

The BEAN1 bean1 (Catalog #AAA3218159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BEAN1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BEAN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BEAN1 bean1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDAPPPYSLT DSCPTLDGTS DSGSGHSPGR HQQEQRTPAQ GGLHTVSMDT. It is sometimes possible for the material contained within the vial of "BEAN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.