Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZNF12Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlZNF12 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit ZNF12 Polyclonal Antibody | anti-ZNF12 antibody

ZNF12 Antibody - N-terminal region

Gene Names
ZNF12; KOX3; HZF11; GIOT-3; ZNF325
Reactivity
Cow, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF12; Polyclonal Antibody; ZNF12 Antibody - N-terminal region; anti-ZNF12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVE
Sequence Length
659
Applicable Applications for anti-ZNF12 antibody
Western Blot (WB)
Homology
Cow: 77%; Horse: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZNF12Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlZNF12 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: ZNF12Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlZNF12 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ZNF12 antibody
This is a rabbit polyclonal antibody against ZNF12. It was validated on Western Blot

Target Description: This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with eight C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in developmental control of gene expression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
zinc finger protein 12 isoform b
NCBI Official Synonym Full Names
zinc finger protein 12
NCBI Official Symbol
ZNF12
NCBI Official Synonym Symbols
KOX3; HZF11; GIOT-3; ZNF325
NCBI Protein Information
zinc finger protein 12
UniProt Protein Name
Zinc finger protein 12
Protein Family
UniProt Gene Name
ZNF12
UniProt Synonym Gene Names
GIOT3; KOX3; ZNF325; GIOT-3
UniProt Entry Name
ZNF12_HUMAN

NCBI Description

This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with eight C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in developmental control of gene expression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

ZNF12: Transcriptional repressor which suppresses activation protein 1 (AP-1)- and serum response element (SRE)-mediated transcriptional activity. Belongs to the krueppel C2H2-type zinc-finger protein family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: nucleoplasm; centrosome; nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Research Articles on ZNF12

Similar Products

Product Notes

The ZNF12 znf12 (Catalog #AAA3210189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF12 Antibody - N-terminal region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF12 znf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EWQQLDPEQK ITYRDVMLEN YSNLVSVGYH IIKPDVISKL EQGEEPWIVE. It is sometimes possible for the material contained within the vial of "ZNF12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.