Western Blot (WB)
(Host: RabbitTarget Name: DEFB119Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Rabbit DEFB119 Polyclonal Antibody | anti-DEFB119 antibody
DEFB119 Antibody - N-terminal region
Gene Names
DEFB119; DEFB20; DEFB-19; DEFB-20; DEFB120; ESC42-RELA; ESC42-RELB
Reactivity
Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DEFB119; Polyclonal Antibody; DEFB119 Antibody - N-terminal region; anti-DEFB119 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNC
Sequence Length
84
Applicable Applications for anti-DEFB119 antibody
Western Blot (WB)
Homology
Dog: 77%; Guinea Pig: 82%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DEFB119
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DEFB119Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DEFB119Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DEFB119 antibody
This is a rabbit polyclonal antibody against DEFB119. It was validated on Western Blot
Target Description: This gene encodes a member of a family of small secreted proteins. These proteins participate in immune defense against microbial infection. This gene is located in a cluster of similar genes on chromosome 20. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a member of a family of small secreted proteins. These proteins participate in immune defense against microbial infection. This gene is located in a cluster of similar genes on chromosome 20. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-DEFB119 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
beta-defensin 119 isoform a
NCBI Official Synonym Full Names
defensin beta 119
NCBI Official Symbol
DEFB119
NCBI Official Synonym Symbols
DEFB20; DEFB-19; DEFB-20; DEFB120; ESC42-RELA; ESC42-RELB
NCBI Protein Information
beta-defensin 119
UniProt Protein Name
Beta-defensin 119
Protein Family
UniProt Gene Name
DEFB119
UniProt Synonym Gene Names
DEFB120; DEFB19; DEFB20; UNQ2449/PRO5729; DEFB-19; DEFB-20
UniProt Entry Name
DB119_HUMAN
NCBI Description
This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
Uniprot Description
defensin, beta 19: Has antibacterial activity (Potential). Belongs to the beta-defensin family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 20q11.21
Cellular Component: cell surface; extracellular region
Biological Process: defense response to bacterium; innate immune response
Research Articles on DEFB119
Similar Products
Product Notes
The DEFB119 defb119 (Catalog #AAA3217779) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEFB119 Antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DEFB119 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DEFB119 defb119 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLYLFLAILL AIEEPVISGK RHILRCMGNS GICRASCKKN EQPYLYCRNC. It is sometimes possible for the material contained within the vial of "DEFB119, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
