Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARHGAP11ASample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ARHGAP11A Polyclonal Antibody | anti-ARHGAP11A antibody

ARHGAP11A Antibody - N-terminal region

Gene Names
ARHGAP11A; GAP (1-12)
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARHGAP11A; Polyclonal Antibody; ARHGAP11A Antibody - N-terminal region; anti-ARHGAP11A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNR
Sequence Length
501
Applicable Applications for anti-ARHGAP11A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 77%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGAP11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARHGAP11ASample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARHGAP11ASample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ARHGAP11A antibody
This is a rabbit polyclonal antibody against ARHGAP11A. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-ARHGAP11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
rho GTPase-activating protein 11A isoform 2
NCBI Official Synonym Full Names
Rho GTPase activating protein 11A
NCBI Official Symbol
ARHGAP11A
NCBI Official Synonym Symbols
GAP (1-12)
NCBI Protein Information
rho GTPase-activating protein 11A
UniProt Protein Name
Rho GTPase-activating protein 11A
UniProt Gene Name
ARHGAP11A
UniProt Synonym Gene Names
KIAA0013
UniProt Entry Name
RHGBA_HUMAN

NCBI Description

This gene encodes a member of the Rho GTPase activating protein family. In response to DNA damage, the encoded protein interacts with the p53 tumor suppressor protein and stimulates its tetramerization, which results in cell-cycle arrest and apoptosis. A chromosomal deletion that includes this gene is one cause of Prader-Willi syndrome, and an intronic variant of this gene may be associated with sleep duration in children. This gene is highly expressed in colon cancers and in a human basal-like breast cancer cell line. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein. [provided by RefSeq, Feb 2019]

Uniprot Description

ARHGAP11A: 2 isoforms of the human protein are produced by alternative splicing

Protein type: GAPs, Rac/Rho; GAPs

Chromosomal Location of Human Ortholog: 15q13.2

Cellular Component: cytosol

Molecular Function: GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; positive regulation of GTPase activity

Research Articles on ARHGAP11A

Similar Products

Product Notes

The ARHGAP11A arhgap11a (Catalog #AAA3217674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGAP11A Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGAP11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGAP11A arhgap11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLGIDGLCAT PSLEGFEEGE YETPGEYKRK RRQSVGDFVS GALNKFKPNR. It is sometimes possible for the material contained within the vial of "ARHGAP11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.