Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SHMT2 is 0.1 ng/ml as a capture antibody.)

Mouse SHMT2 Monoclonal Antibody | anti-SHMT2 antibody

SHMT2 (Serine Hydroxymethyltransferase 2 (Mitochondrial), GLYA, SHMT) (Biotin)

Gene Names
SHMT2; GLYA; SHMT; HEL-S-51e
Applications
Western Blot
Purity
Purified
Synonyms
SHMT2; Monoclonal Antibody; SHMT2 (Serine Hydroxymethyltransferase 2 (Mitochondrial); GLYA; SHMT) (Biotin); Serine Hydroxymethyltransferase 2 (Mitochondrial); SHMT; anti-SHMT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
50000000
Specificity
Recognizes SHMT2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
504
Applicable Applications for anti-SHMT2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SHMT2 (NP_005403.2, 401aa-503aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SHMT2 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SHMT2 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(SHMT2 monoclonal antibody (M04), clone 5E7. Western Blot analysis of SHMT2 expression in HeLa.)

Western Blot (WB) (SHMT2 monoclonal antibody (M04), clone 5E7. Western Blot analysis of SHMT2 expression in HeLa.)
Related Product Information for anti-SHMT2 antibody
Mouse monoclonal antibody raised against a partial recombinant SHMT2.
Product Categories/Family for anti-SHMT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine hydroxymethyltransferase, mitochondrial isoform 1
NCBI Official Synonym Full Names
serine hydroxymethyltransferase 2
NCBI Official Symbol
SHMT2
NCBI Official Synonym Symbols
GLYA; SHMT; HEL-S-51e
NCBI Protein Information
serine hydroxymethyltransferase, mitochondrial
UniProt Protein Name
Serine hydroxymethyltransferase, mitochondrial
UniProt Gene Name
SHMT2
UniProt Synonym Gene Names
SHMT
UniProt Entry Name
GLYM_HUMAN

NCBI Description

This gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glycine synthesis. The activity of the encoded protein has been suggested to be the primary source of intracellular glycine. The gene which encodes the cytosolic form of this enzyme is located on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

SHMT2: Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Interconversion of serine and glycine. Associates with mitochondrial DNA. Belongs to the SHMT family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Methyltransferase; Energy Metabolism - methane; Cofactor and Vitamin Metabolism - one carbon pool by folate; Mitochondrial; EC 2.1.2.1; Other Amino Acids Metabolism - cyanoamino acid

Chromosomal Location of Human Ortholog: 12q12-q14

Cellular Component: microtubule cytoskeleton; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; mitochondrial intermembrane space

Molecular Function: L-allo-threonine aldolase activity; identical protein binding; amino acid binding; glycine hydroxymethyltransferase activity; chromatin binding; pyridoxal phosphate binding

Biological Process: L-serine biosynthetic process; positive regulation of cell proliferation; one-carbon compound metabolic process; glycine biosynthetic process from serine; protein homotetramerization

Research Articles on SHMT2

Similar Products

Product Notes

The SHMT2 shmt2 (Catalog #AAA6174506) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SHMT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SHMT2 shmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHMT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.