Western Blot (WB)
(WB Suggested Anti-ENPEP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Rabbit ENPEP Polyclonal Antibody | anti-ENPEP antibody
ENPEP Antibody - C-terminal region
Gene Names
ENPEP; APA; CD249; gp160
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENPEP; Polyclonal Antibody; ENPEP Antibody - C-terminal region; anti-ENPEP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLI
Sequence Length
957
Applicable Applications for anti-ENPEP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 83%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ENPEP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ENPEP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Western Blot (WB)
(WB Suggested Anti-ENPEP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-ENPEP antibody
This is a rabbit polyclonal antibody against ENPEP. It was validated on Western Blot
Target Description: ENPEP appears to have a role in the catabolic pathway of the renin-angiotensin system. ENPEP probably plays a role in regulating growth and differentiation of early B-lineage cells.
Target Description: ENPEP appears to have a role in the catabolic pathway of the renin-angiotensin system. ENPEP probably plays a role in regulating growth and differentiation of early B-lineage cells.
Product Categories/Family for anti-ENPEP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
glutamyl aminopeptidase
NCBI Official Synonym Full Names
glutamyl aminopeptidase
NCBI Official Symbol
ENPEP
NCBI Official Synonym Symbols
APA; CD249; gp160
NCBI Protein Information
glutamyl aminopeptidase
UniProt Protein Name
Glutamyl aminopeptidase
UniProt Gene Name
ENPEP
UniProt Synonym Gene Names
EAP; AP-A
Uniprot Description
Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.
Research Articles on ENPEP
Similar Products
Product Notes
The ENPEP enpep (Catalog #AAA3216823) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENPEP Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENPEP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENPEP enpep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEISWNYTLE QYQKTSLAQE KEKLLYGLAS VKNVTLLSRY LDLLKDTNLI. It is sometimes possible for the material contained within the vial of "ENPEP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
