Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glutamyl aminopeptidase Recombinant Protein | ENPEP recombinant protein

Recombinant Human Glutamyl aminopeptidase

Gene Names
ENPEP; APA; CD249; gp160
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamyl aminopeptidase; Recombinant Human Glutamyl aminopeptidase; Aminopeptidase A; AP-A; Differentiation antigen gp160; CD249; ENPEP recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
719-949aa; Extracellular Domain
Sequence
YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW
Sequence Length
957
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for ENPEP recombinant protein
Appears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells.
Product Categories/Family for ENPEP recombinant protein
References
Molecular cloning of the human kidney differentiation antigen gp160 human aminopeptidase A.Nanus D.M., Engelstein D., Gastl G.A., Gluck L., Vidal M.J., Morrison M., Finstad C.L., Bander N.H., Albino A.P.Proc. Natl. Acad. Sci. U.S.A. 90:7069-7073(1993) cDNA cloning and expression of human glutamyl aminopeptidase (aminopeptidase A) .Li L., Wang J., Cooper M.D.Genomics 17:657-664(1993) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
glutamyl aminopeptidase
NCBI Official Synonym Full Names
glutamyl aminopeptidase
NCBI Official Symbol
ENPEP
NCBI Official Synonym Symbols
APA; CD249; gp160
NCBI Protein Information
glutamyl aminopeptidase
UniProt Protein Name
Glutamyl aminopeptidase
Protein Family
UniProt Gene Name
ENPEP
UniProt Synonym Gene Names
EAP; AP-A
UniProt Entry Name
AMPE_HUMAN

Uniprot Description

ENPEP: Appears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells. Belongs to the peptidase M1 family.

Protein type: Protease; Membrane protein, integral; EC 3.4.11.7

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: apical part of cell; apical plasma membrane; brush border; cytoplasmic vesicle; external side of plasma membrane; integral to plasma membrane; lysosomal membrane; plasma membrane

Molecular Function: aminopeptidase activity; metallopeptidase activity; peptide binding; zinc ion binding

Biological Process: angiogenesis; angiotensin catabolic process in blood; angiotensin maturation; cell migration; cell proliferation; cell-cell signaling; cellular protein metabolic process; glomerulus development; peptide catabolic process; regulation of systemic arterial blood pressure by renin-angiotensin

Research Articles on ENPEP

Similar Products

Product Notes

The ENPEP enpep (Catalog #AAA1265551) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 719-949aa; Extracellular Domain. The amino acid sequence is listed below: YFQGQVKPIA DSLGWNDAGD HVTKLLRSSV LGFACKMGDR EALNNASSLF EQWLNGTVSL PVNLRLLVYR YGMQNSGNEI SWNYTLEQYQ KTSLAQEKEK LLYGLASVKN VTLLSRYLDL LKDTNLIKTQ DVFTVIRYIS YNSYGKNMAW NWIQLNWDYL VNRYTLNNRN LGRIVTIAEP FNTELQLWQM ESFFAKYPQA GAGEKPREQV LETVKNNIEW LKQHRNTIRE W. It is sometimes possible for the material contained within the vial of "Glutamyl aminopeptidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.