Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Ppp3cb AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Ppp3cb Polyclonal Antibody | anti-PPP3CB antibody

Ppp3cb antibody - C-terminal region

Gene Names
Ppp3cb; Cnab; Calnb; CnAbeta; 1110063J16Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ppp3cb; Polyclonal Antibody; Ppp3cb antibody - C-terminal region; anti-PPP3CB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
Sequence Length
525
Applicable Applications for anti-PPP3CB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Ppp3cb AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Ppp3cb AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-PPP3CB antibody
This is a rabbit polyclonal antibody against Ppp3cb. It was validated on Western Blot

Target Description: Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 3, catalytic subunit, beta isoform
NCBI Official Symbol
Ppp3cb
NCBI Official Synonym Symbols
Cnab; Calnb; CnAbeta; 1110063J16Rik
NCBI Protein Information
serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
UniProt Gene Name
Ppp3cb
UniProt Synonym Gene Names
Calnb
UniProt Entry Name
PP2BB_MOUSE

Uniprot Description

PPP3CB: a calmodulin-dependent Ser/Thr phosphatase also known calcineurin A beta. Involved in a wide range of biologic activities, acting as a Ca(2 )-dependent modifier of phosphorylation status. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively.

Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor)

Cellular Component: protein complex; T-tubule; plasma membrane; calcineurin complex; Z disc

Molecular Function: protein dimerization activity; hydrolase activity; metal ion binding; calcium ion binding; protein serine/threonine phosphatase activity; drug binding; protein phosphatase 2B binding; calmodulin binding; protein binding; calmodulin-dependent protein phosphatase activity; enzyme binding; calcium-dependent protein serine/threonine phosphatase activity; protein heterodimerization activity; phosphoprotein phosphatase activity

Biological Process: positive regulation of NFAT protein import into nucleus; heart development; protein amino acid dephosphorylation; protein amino acid phosphorylation; calcium ion-dependent exocytosis; locomotion during locomotory behavior; calcineurin-NFAT signaling pathway; dephosphorylation; regulation of gene expression; response to cytokine stimulus; negative regulation of T cell mediated cytotoxicity; lymphangiogenesis; response to stress; positive regulation of transcription from RNA polymerase II promoter; T cell homeostasis; regulation of insulin secretion; T cell differentiation

Research Articles on PPP3CB

Similar Products

Product Notes

The PPP3CB ppp3cb (Catalog #AAA3213401) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ppp3cb antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Ppp3cb can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP3CB ppp3cb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESVLTLKGLT PTGMLPSGVL AGGRQTLQSA TVEAIEAEKA IRGFSPPHRI. It is sometimes possible for the material contained within the vial of "Ppp3cb, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.