Western Blot (WB)
(Western Blot detection against Immunogen (35.64kD).)
Mouse anti-Human CALNA2 Monoclonal Antibody | anti-CALNA2 antibody
CALNA2 (Calmodulin-dependent Calcineurin A Subunit, beta Isoform, Serine/Threonine Protein Phosphatase 2B Catalytic Subunit, beta Isoform, CAM-PRP Catalytic Subunit, PPP3CB, CNA2) (PE)
Gene Names
PPP3CB; CNA2; CALNB; CALNA2; PP2Bbeta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CALNA2; Monoclonal Antibody; CALNA2 (Calmodulin-dependent Calcineurin A Subunit; beta Isoform; Serine/Threonine Protein Phosphatase 2B Catalytic Subunit; CAM-PRP Catalytic Subunit; PPP3CB; CNA2) (PE); anti-CALNA2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5D3
Specificity
Recognizes human PPP3CB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CALNA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa435-524 from human PPP3CB (NP_066955) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.64kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.64kD).)
Western Blot (WB)
(Western Blot analysis of PPP3CB expression in transfected 293T cell line by PPP3CB monoclonal antibody. Lane 1: PPP3CB transfected lysate (59.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PPP3CB expression in transfected 293T cell line by PPP3CB monoclonal antibody. Lane 1: PPP3CB transfected lysate (59.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CALNA2 antibody
PPP3CB is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Product Categories/Family for anti-CALNA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,123 Da
NCBI Official Full Name
serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform b
NCBI Official Synonym Full Names
protein phosphatase 3, catalytic subunit, beta isozyme
NCBI Official Symbol
PPP3CB
NCBI Official Synonym Symbols
CNA2; CALNB; CALNA2; PP2Bbeta
NCBI Protein Information
serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Research Articles on CALNA2
Similar Products
Product Notes
The CALNA2 (Catalog #AAA6156851) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CALNA2 (Calmodulin-dependent Calcineurin A Subunit, beta Isoform, Serine/Threonine Protein Phosphatase 2B Catalytic Subunit, beta Isoform, CAM-PRP Catalytic Subunit, PPP3CB, CNA2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CALNA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CALNA2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CALNA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
