Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP3R1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Rabbit PPP3R1 Polyclonal Antibody | anti-PPP3R1 antibody

PPP3R1 antibody - N-terminal region

Gene Names
PPP3R1; CNB; CNB1; CALNB1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP3R1; Polyclonal Antibody; PPP3R1 antibody - N-terminal region; anti-PPP3R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ
Sequence Length
170
Applicable Applications for anti-PPP3R1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP3R1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-PPP3R1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-PPP3R1 antibody
This is a rabbit polyclonal antibody against PPP3R1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
calcineurin subunit B type 1
NCBI Official Synonym Full Names
protein phosphatase 3 regulatory subunit B, alpha
NCBI Official Symbol
PPP3R1
NCBI Official Synonym Symbols
CNB; CNB1; CALNB1
NCBI Protein Information
calcineurin subunit B type 1
UniProt Protein Name
Calcineurin subunit B type 1
UniProt Gene Name
PPP3R1
UniProt Synonym Gene Names
CNA2; CNB
UniProt Entry Name
CANB1_HUMAN

Uniprot Description

PPP3R1: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. Belongs to the calcineurin regulatory subunit family.

Protein type: Protein phosphatase, regulatory subunit; Cell development/differentiation; Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p15

Cellular Component: nucleoplasm; cytosol; calcineurin complex; sarcolemma

Molecular Function: calmodulin binding; protein domain specific binding; protein binding; calcium-dependent protein serine/threonine phosphatase activity; calcium ion binding

Biological Process: calcineurin-NFAT signaling pathway; positive regulation of NFAT protein import into nucleus; dephosphorylation; apoptosis; innate immune response; positive regulation of transcription from RNA polymerase II promoter

Research Articles on PPP3R1

Similar Products

Product Notes

The PPP3R1 ppp3r1 (Catalog #AAA3212573) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP3R1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP3R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP3R1 ppp3r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGNEASYPLE MCSHFDADEI KRLGKRFKKL DLDNSGSLSV EEFMSLPELQ. It is sometimes possible for the material contained within the vial of "PPP3R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.