Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PPP3CA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit PPP3CA Polyclonal Antibody | anti-PPP3CA antibody

PPP3CA antibody - middle region

Gene Names
PPP3CA; CALN; CCN1; CNA1; CALNA; IECEE; PPP2B; ACCIID; CALNA1; IECEE1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP3CA; Polyclonal Antibody; PPP3CA antibody - middle region; anti-PPP3CA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
Sequence Length
521
Applicable Applications for anti-PPP3CA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP3CA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PPP3CA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-PPP3CA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellumObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: MouseTarget Name: PPP3CASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PPP3CASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PPP3CASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP3CASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PPP3CASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP3CASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PPP3CASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP3CASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PPP3CASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP3CASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PPP3CA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-PPP3CA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-PPP3CA antibody
This is a rabbit polyclonal antibody against PPP3CA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP3CA belongs to the PPP phosphatase family, PP-2B subfamily. It is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. PPP3CA dephosphorylates HSPB1 and SSH1.
Product Categories/Family for anti-PPP3CA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 3 catalytic subunit alpha
NCBI Official Symbol
PPP3CA
NCBI Official Synonym Symbols
CALN; CCN1; CNA1; CALNA; IECEE; PPP2B; ACCIID; CALNA1; IECEE1
NCBI Protein Information
serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
UniProt Gene Name
PPP3CA
UniProt Synonym Gene Names
CALNA; CNA
UniProt Entry Name
PP2BA_HUMAN

Uniprot Description

PPP3CA: a calmodulin-dependent Ser/Thr phosphatase also known calcineurin A alpha. Involved in a wide range of biologic activities, acting as a Ca(2 )-dependent modifier of phosphorylation status. Dephosphorylates HSPB1. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. .

Protein type: Protein phosphatase, Ser/Thr (non-receptor); EC 3.1.3.16

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; Z disc; cytosol; calcineurin complex; sarcolemma

Molecular Function: calmodulin binding; protein dimerization activity; protein binding; enzyme binding; calmodulin-dependent protein phosphatase activity; protein heterodimerization activity; protein serine/threonine phosphatase activity; drug binding; calcium ion binding

Biological Process: regulation of synaptic transmission; positive regulation of NFAT protein import into nucleus; T cell activation; response to amphetamine; skeletal muscle fiber development; protein amino acid dephosphorylation; negative regulation of insulin secretion; calcineurin-NFAT signaling pathway; transition between fast and slow fiber; dephosphorylation; protein import into nucleus; calcium ion transport; innate immune response; positive regulation of transcription from RNA polymerase II promoter; response to calcium ion; regulation of excitatory postsynaptic membrane potential; multicellular organismal response to stress; G1/S transition of mitotic cell cycle

Research Articles on PPP3CA

Similar Products

Product Notes

The PPP3CA ppp3ca (Catalog #AAA3210319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP3CA antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP3CA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP3CA ppp3ca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPSGVLSGGK QTLQSATVEA IEADEAIKGF SPQHKITSFE EAKGLDRINE. It is sometimes possible for the material contained within the vial of "PPP3CA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.