Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DYH6Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DNAH6 Polyclonal Antibody | anti-DNAH6 antibody

DNAH6 Antibody - middle region

Gene Names
DNAH6; HL2; HL-2; DNHL1; Dnahc6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DNAH6; Polyclonal Antibody; DNAH6 Antibody - middle region; anti-DNAH6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL
Sequence Length
408
Applicable Applications for anti-DNAH6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human DYH6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DYH6Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DYH6Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DNAH6 antibody
This is a rabbit polyclonal antibody against DYH6. It was validated on Western Blot

Target Description: This gene belongs to the dynein family, whose members encode large proteins that are constituents of the microtubule-associated motor protein complex. This complex is composed of dynein heavy, intermediate and light chains, which can be axonemal or cytoplasmic. This protein is an axonemal dynein heavy chain. It is involved in producing force for ciliary beating by using energy from ATP hydrolysis. Mutations in this gene may cause primary ciliary dyskinesia (PCD) as well as heterotaxy.
Product Categories/Family for anti-DNAH6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
dynein heavy chain 6, axonemal
NCBI Official Synonym Full Names
dynein axonemal heavy chain 6
NCBI Official Symbol
DNAH6
NCBI Official Synonym Symbols
HL2; HL-2; DNHL1; Dnahc6
NCBI Protein Information
dynein heavy chain 6, axonemal
UniProt Protein Name
Dynein heavy chain 6, axonemal
Protein Family
UniProt Gene Name
DNAH6
UniProt Synonym Gene Names
DNAHC6; DNHL1; HL2; KIAA1697
UniProt Entry Name
DYH6_HUMAN

NCBI Description

This gene belongs to the dynein family, whose members encode large proteins that are constituents of the microtubule-associated motor protein complex. This complex is composed of dynein heavy, intermediate and light chains, which can be axonemal or cytoplasmic. This protein is an axonemal dynein heavy chain. It is involved in producing force for ciliary beating by using energy from ATP hydrolysis. Mutations in this gene may cause primary ciliary dyskinesia (PCD) as well as heterotaxy. [provided by RefSeq, Jun 2016]

Uniprot Description

DNAH6: Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Belongs to the dynein heavy chain family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: microtubule; axonemal dynein complex

Molecular Function: ATPase activity; microtubule motor activity; ATP binding

Biological Process: metabolic process; ciliary or flagellar motility; microtubule-based movement

Research Articles on DNAH6

Similar Products

Product Notes

The DNAH6 dnah6 (Catalog #AAA3212343) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAH6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAH6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNAH6 dnah6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QIFFKENESL DLQALKLQEP DINFFSEQLE KYHKQHKDAV ALRPTRNVGL. It is sometimes possible for the material contained within the vial of "DNAH6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.