Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DYNC1I2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DYNC1I2 Polyclonal Antibody | anti-DYNC1I2 antibody

DYNC1I2 Antibody - middle region

Gene Names
DYNC1I2; IC2; DIC74; DNCI2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DYNC1I2; Polyclonal Antibody; DYNC1I2 Antibody - middle region; anti-DYNC1I2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYV
Sequence Length
608
Applicable Applications for anti-DYNC1I2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DYNC1I2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DYNC1I2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DYNC1I2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DYNC1I2 antibody
This gene encodes a member of the dynein intermediate chain family. The encoded protein is a non-catalytic component of the cytoplasmic dynein 1 complex, which acts as a retrograde microtubule motor to transport organelles and vesicles. A pseudogene of this gene is located on chromosome 10. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-DYNC1I2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66 kDa
NCBI Official Full Name
cytoplasmic dynein 1 intermediate chain 2 isoform 1
NCBI Official Synonym Full Names
dynein cytoplasmic 1 intermediate chain 2
NCBI Official Symbol
DYNC1I2
NCBI Official Synonym Symbols
IC2; DIC74; DNCI2
NCBI Protein Information
cytoplasmic dynein 1 intermediate chain 2
UniProt Protein Name
Cytoplasmic dynein 1 intermediate chain 1
Protein Family
UniProt Gene Name
DYNC1I1
UniProt Synonym Gene Names
DNCI1; DNCIC1; DH IC-1
UniProt Entry Name
DC1I1_HUMAN

NCBI Description

This gene encodes a member of the dynein intermediate chain family. The encoded protein is a non-catalytic component of the cytoplasmic dynein 1 complex, which acts as a retrograde microtubule motor to transport organelles and vesicles. A pseudogene of this gene is located on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Uniprot Description

DYNC1I1: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150- glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores. Belongs to the dynein intermediate chain family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Microtubule-binding; Motor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: kinetochore; spindle pole; microtubule; recycling endosome; cytoplasmic dynein complex; perinuclear region of cytoplasm; cytosol; vesicle

Molecular Function: protein binding; spectrin binding; microtubule binding; motor activity; microtubule motor activity

Biological Process: metabolic process; vesicle transport along microtubule; antigen processing and presentation of exogenous peptide antigen via MHC class II

Research Articles on DYNC1I2

Similar Products

Product Notes

The DYNC1I2 dync1i1 (Catalog #AAA3222932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYNC1I2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYNC1I2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DYNC1I2 dync1i1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HRVVSCLDWS SQYPELLVAS YNNNEDAPHE PDGVALVWNM KYKKTTPEYV. It is sometimes possible for the material contained within the vial of "DYNC1I2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.