Western Blot (WB)
(Western blot analysis of extracts of Mouse testis, using DNAH5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Rabbit anti-Mouse, Rat DNAH5 Polyclonal Antibody | anti-DNAH5 antibody
DNAH5 Rabbit pAb
Gene Names
DNAH5; HL1; PCD; CILD3; KTGNR; DNAHC5
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
DNAH5; Polyclonal Antibody; DNAH5 Rabbit pAb; CILD3; DNAHC5; HL1; KTGNR; PCD; anti-DNAH5 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
VTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQQHPAV
Applicable Applications for anti-DNAH5 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 400-650 of human DNAH5 (NP_001360.1).
Positive Samples
Mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Mouse testis, using DNAH5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Western Blot (WB)
(Western blot analysis of extracts of Mouse testis, using DNAH5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-DNAH5 antibody
Background: This gene encodes a dynein protein, which is part of a microtubule-associated motor protein complex consisting of heavy, light, and intermediate chains. This protein is an axonemal heavy chain dynein. It functions as a force-generating protein with ATPase activity, whereby the release of ADP is thought to produce the force-producing power stroke. Mutations in this gene cause primary ciliary dyskinesia type 3, as well as Kartagener syndrome, which are both diseases due to ciliary defects. [provided by RefSeq, Oct 2009]
Product Categories/Family for anti-DNAH5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
529,021 Da
NCBI Official Full Name
dynein heavy chain 5, axonemal
NCBI Official Synonym Full Names
dynein, axonemal, heavy chain 5
NCBI Official Symbol
DNAH5
NCBI Official Synonym Symbols
HL1; PCD; CILD3; KTGNR; DNAHC5
NCBI Protein Information
dynein heavy chain 5, axonemal; ciliary dynein heavy chain 5; axonemal beta dynein heavy chain 5; dynein, axonemal, heavy polypeptide 5
UniProt Protein Name
Dynein heavy chain 5, axonemal
Protein Family
UniProt Gene Name
DNAH5
UniProt Synonym Gene Names
DNAHC5; HL1; KIAA1603
UniProt Entry Name
DYH5_HUMAN
Similar Products
Product Notes
The DNAH5 dnah5 (Catalog #AAA9142784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAH5 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNAH5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DNAH5 dnah5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VTNQIISACK AYITNNGTAS IWNQPQDVVE EKILSAIKLK QEYQLCFHKT KQKLKQNPNA KQFDFSEMYI FGKFETFHRR LAKIIDIFTT LKTYSVLQDS TIEGLEDMAT KYQGIVATIK KKEYNFLDQR KMDFDQDYEE FCKQTNDLHN ELRKFMDVTF AKIQNTNQAL RMLKKFERLN IPNLGIDDKY QLILENYGAD IDMISKLYTK QKYDPPLARN QPPIAGKILW ARQLFHRIQQ PMQLFQQHPA V. It is sometimes possible for the material contained within the vial of "DNAH5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
