Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYL6BSample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MYL6B Polyclonal Antibody | anti-MYL6B antibody

MYL6B Antibody - middle region

Gene Names
MYL6B; MLC1SA
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
MYL6B; Polyclonal Antibody; MYL6B Antibody - middle region; anti-MYL6B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFL
Sequence Length
208
Applicable Applications for anti-MYL6B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MYL6B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYL6BSample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYL6BSample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYL6B antibody
This is a rabbit polyclonal antibody against MYL6B. It was validated on Western Blot

Target Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-MYL6B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
myosin light chain 6B
NCBI Official Synonym Full Names
myosin light chain 6B
NCBI Official Symbol
MYL6B
NCBI Official Synonym Symbols
MLC1SA
NCBI Protein Information
myosin light chain 6B
UniProt Protein Name
Myosin light chain 6B
Protein Family
UniProt Gene Name
MYL6B
UniProt Synonym Gene Names
MLC1SA; MLC1sa
UniProt Entry Name
MYL6B_HUMAN

NCBI Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]

Uniprot Description

MYL6B: Regulatory light chain of myosin. Does not bind calcium.

Protein type: Contractile; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: unconventional myosin complex; muscle myosin complex; myosin complex; cytosol

Molecular Function: protein binding; structural constituent of muscle; motor activity; calcium ion binding

Biological Process: skeletal muscle development; muscle contraction; metabolic process; muscle filament sliding

Research Articles on MYL6B

Similar Products

Product Notes

The MYL6B myl6b (Catalog #AAA3210558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYL6B Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYL6B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYL6B myl6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGDGKILYSQ CGDVMRALGQ NPTNAEVLKV LGNPKSDELK SRRVDFETFL. It is sometimes possible for the material contained within the vial of "MYL6B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.