Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-COTL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Rabbit COTL1 Polyclonal Antibody | anti-COTL1 antibody

COTL1 antibody - N-terminal region

Gene Names
COTL1; CLP
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COTL1; Polyclonal Antibody; COTL1 antibody - N-terminal region; anti-COTL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ
Sequence Length
142
Applicable Applications for anti-COTL1 antibody
Western Blot (WB)
Homology
Cow: 85%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COTL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-COTL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-COTL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Related Product Information for anti-COTL1 antibody
This is a rabbit polyclonal antibody against COTL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has
Product Categories/Family for anti-COTL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
coactosin-like protein
NCBI Official Synonym Full Names
coactosin like F-actin binding protein 1
NCBI Official Symbol
COTL1
NCBI Official Synonym Symbols
CLP
NCBI Protein Information
coactosin-like protein
UniProt Protein Name
Coactosin-like protein
Protein Family
UniProt Gene Name
COTL1
UniProt Synonym Gene Names
CLP
UniProt Entry Name
COTL1_HUMAN

NCBI Description

This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008]

Uniprot Description

COTL1: Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Belongs to the actin-binding proteins ADF family. Coactosin subfamily.

Protein type: Actin-binding

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: nuclear membrane; cytoskeleton; cytoplasm

Molecular Function: protein binding; enzyme binding; actin binding

Biological Process: defense response to fungus

Research Articles on COTL1

Similar Products

Product Notes

The COTL1 cotl1 (Catalog #AAA3212187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COTL1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COTL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COTL1 cotl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATKIDKEAC RAAYNLVRDD GSAVIWVTFK YDGSTIVPGE QGAEYQHFIQ. It is sometimes possible for the material contained within the vial of "COTL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.