Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RAB39B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

Rabbit RAB39B Polyclonal Antibody | anti-RAB39B antibody

RAB39B antibody - N-terminal region

Gene Names
RAB39B; WSN; BGMR; WSMN; MRX72
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB39B; Polyclonal Antibody; RAB39B antibody - N-terminal region; anti-RAB39B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV
Sequence Length
213
Applicable Applications for anti-RAB39B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RAB39B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RAB39B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-RAB39B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)
Related Product Information for anti-RAB39B antibody
This is a rabbit polyclonal antibody against RAB39B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RAB39B may be involved in vesicular trafficking.This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking.
Product Categories/Family for anti-RAB39B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-39B
NCBI Official Synonym Full Names
RAB39B, member RAS oncogene family
NCBI Official Symbol
RAB39B
NCBI Official Synonym Symbols
WSN; BGMR; WSMN; MRX72
NCBI Protein Information
ras-related protein Rab-39B
UniProt Protein Name
Ras-related protein Rab-39B
Protein Family
UniProt Gene Name
RAB39B
UniProt Entry Name
RB39B_HUMAN

NCBI Description

This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. [provided by RefSeq, Aug 2013]

Uniprot Description

RAB39B: May be involved in vesicular trafficking. Plays a role in synapse formation. Defects in RAB39B are the cause of mental retardation X- linked type 72 (MRX72). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRX72 patients can manifest autism spectrum disorder, seizures and macrocephaly as additional features. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: Golgi apparatus; intracellular; neuron projection; vesicle

Molecular Function: myosin V binding; protein binding

Biological Process: synapse organization and biogenesis; vesicle-mediated transport

Disease: Mental Retardation, X-linked 72

Research Articles on RAB39B

Similar Products

Product Notes

The RAB39B rab39b (Catalog #AAA3211196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB39B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB39B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB39B rab39b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEAIWLYQFR LIVIGDSTVG KSCLIRRFTE GRFAQVSDPT VGVDFFSRLV. It is sometimes possible for the material contained within the vial of "RAB39B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.