Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit HIBADH Polyclonal Antibody | anti-HIBADH antibody

HIBADH antibody - middle region

Gene Names
HIBADH; NS5ATP1
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIBADH; Polyclonal Antibody; HIBADH antibody - middle region; anti-HIBADH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG
Sequence Length
336
Applicable Applications for anti-HIBADH antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HIBADH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HIBADH antibody
This is a rabbit polyclonal antibody against HIBADH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
Product Categories/Family for anti-HIBADH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
3-hydroxyisobutyrate dehydrogenase, mitochondrial
NCBI Official Synonym Full Names
3-hydroxyisobutyrate dehydrogenase
NCBI Official Symbol
HIBADH
NCBI Official Synonym Symbols
NS5ATP1
NCBI Protein Information
3-hydroxyisobutyrate dehydrogenase, mitochondrial
UniProt Protein Name
3-hydroxyisobutyrate dehydrogenase, mitochondrial
UniProt Gene Name
HIBADH
UniProt Synonym Gene Names
HIBADH
UniProt Entry Name
3HIDH_HUMAN

NCBI Description

This gene encodes a mitochondrial 3-hydroxyisobutyrate dehydrogenase enzyme. The encoded protein plays a critical role in the catabolism of L-valine by catalyzing the oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde. [provided by RefSeq, Nov 2011]

Uniprot Description

HIBADH: a mitochondrial 3-hydroxyisobutyrate dehydrogenase enzyme. The encoded protein plays a critical role in the catabolism of L-valine by catalyzing the oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde. [provided by RefSeq, Nov 2011]

Protein type: EC 1.1.1.31; Mitochondrial; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Oxidoreductase

Chromosomal Location of Human Ortholog: 7p15.2

Cellular Component: mitochondrial matrix

Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity; 3-hydroxyisobutyrate dehydrogenase activity; NAD binding

Biological Process: pentose-phosphate shunt; valine catabolic process; branched chain family amino acid catabolic process

Research Articles on HIBADH

Similar Products

Product Notes

The HIBADH hibadh (Catalog #AAA3211133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIBADH antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HIBADH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIBADH hibadh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKEVEKMGAV FMDAPVSGGV GAARSGNLTF MVGGVEDEFA AAQELLGCMG. It is sometimes possible for the material contained within the vial of "HIBADH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.