Western Blot (WB)
(WB Suggested Anti-SLC25A21 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Rabbit SLC25A21 Polyclonal Antibody | anti-SLC25A21 antibody
SLC25A21 antibody - middle region
Gene Names
SLC25A21; ODC; ODC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC25A21; Polyclonal Antibody; SLC25A21 antibody - middle region; anti-SLC25A21 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL
Sequence Length
299
Applicable Applications for anti-SLC25A21 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC25A21
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SLC25A21 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SLC25A21 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-SLC25A21 antibody
This is a rabbit polyclonal antibody against SLC25A21. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of
Target Description: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of
Product Categories/Family for anti-SLC25A21 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33kDa
NCBI Official Full Name
mitochondrial 2-oxodicarboxylate carrier isoform 1
NCBI Official Synonym Full Names
solute carrier family 25 member 21
NCBI Official Symbol
SLC25A21
NCBI Official Synonym Symbols
ODC; ODC1
NCBI Protein Information
mitochondrial 2-oxodicarboxylate carrier
UniProt Protein Name
Mitochondrial 2-oxodicarboxylate carrier
Protein Family
UniProt Gene Name
SLC25A21
UniProt Synonym Gene Names
ODC
UniProt Entry Name
ODC_PONAB
NCBI Description
SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.[supplied by OMIM, Apr 2004]
Uniprot Description
Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate ().
Research Articles on SLC25A21
Similar Products
Product Notes
The SLC25A21 slc25a21 (Catalog #AAA3207179) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A21 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC25A21 slc25a21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLSGTIASVI NIPFDVAKSR IQGPQPVPGE IKYRTCFKTM ATVYQEEGIL. It is sometimes possible for the material contained within the vial of "SLC25A21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
