Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PHGDH antibodyFormalin Fixed Paraffin Embedded Tissue: Human PancreasPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit PHGDH Polyclonal Antibody | anti-PHGDH antibody

PHGDH antibody - middle region

Gene Names
PHGDH; NLS; PDG; PGD; NLS1; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; PHGDHD; HEL-S-113
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PHGDH; Polyclonal Antibody; PHGDH antibody - middle region; anti-PHGDH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF
Sequence Length
533
Applicable Applications for anti-PHGDH antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PHGDH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PHGDH antibodyFormalin Fixed Paraffin Embedded Tissue: Human PancreasPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PHGDH antibodyFormalin Fixed Paraffin Embedded Tissue: Human PancreasPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PHGDH antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PHGDH antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-PHGDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysatePHGDH is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-PHGDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysatePHGDH is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-PHGDH antibody
This is a rabbit polyclonal antibody against PHGDH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM].
Product Categories/Family for anti-PHGDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
D-3-phosphoglycerate dehydrogenase
NCBI Official Synonym Full Names
phosphoglycerate dehydrogenase
NCBI Official Symbol
PHGDH
NCBI Official Synonym Symbols
NLS; PDG; PGD; NLS1; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; PHGDHD; HEL-S-113
NCBI Protein Information
D-3-phosphoglycerate dehydrogenase
UniProt Protein Name
D-3-phosphoglycerate dehydrogenase
UniProt Gene Name
PHGDH
UniProt Synonym Gene Names
PGDH3; 3-PGDH
UniProt Entry Name
SERA_HUMAN

NCBI Description

This gene encodes the enzyme which is involved in the early steps of L-serine synthesis in animal cells. L-serine is required for D-serine and other amino acid synthesis. The enzyme requires NAD/NADH as a cofactor and forms homotetramers for activity. Mutations in this gene have been found in a family with congenital microcephaly, psychomotor retardation and other symptoms. Multiple alternatively spliced transcript variants have been found, however the full-length nature of most are not known. [provided by RefSeq, Aug 2011]

Uniprot Description

PHGDH: Defects in PHGDH are the cause of phosphoglycerate dehydrogenase deficiency (PHGDH deficiency). It is characterized by congenital microcephaly, psychomotor retardation, and seizures. Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.

Protein type: Oxidoreductase; Amino Acid Metabolism - glycine, serine and threonine; EC 1.1.1.95; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1p12

Cellular Component: cytosol

Molecular Function: electron carrier activity; NAD binding; phosphoglycerate dehydrogenase activity

Biological Process: neural tube development; glial cell development; glycine metabolic process; gamma-aminobutyric acid metabolic process; glutamine metabolic process; L-serine biosynthetic process; spinal cord development; regulation of gene expression; amino acid biosynthetic process; brain development; taurine metabolic process; neurite development; threonine metabolic process

Disease: Phosphoglycerate Dehydrogenase Deficiency; Neu-laxova Syndrome 1

Research Articles on PHGDH

Similar Products

Product Notes

The PHGDH phgdh (Catalog #AAA3211870) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHGDH antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PHGDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PHGDH phgdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CAGAALDVFT EEPPRDRALV DHENVISCPH LGASTKEAQS RCGEEIAVQF. It is sometimes possible for the material contained within the vial of "PHGDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.