Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TNFRSF12ASample Tissue: Mouse ThymusAntibody Dilution: 1ug/ml)

Rabbit Tnfrsf12a Polyclonal Antibody | anti-TNFRSF12A antibody

Tnfrsf12a antibody - N-terminal region

Gene Names
Tnfrsf12a; Fn14; HPIP; C87282; TweakR; TWEAK-R; AI255180
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tnfrsf12a; Polyclonal Antibody; Tnfrsf12a antibody - N-terminal region; anti-TNFRSF12A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM
Sequence Length
129
Applicable Applications for anti-TNFRSF12A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TNFRSF12ASample Tissue: Mouse ThymusAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TNFRSF12ASample Tissue: Mouse ThymusAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-Tnfrsf12a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Western Blot (WB) (WB Suggested Anti-Tnfrsf12a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-TNFRSF12A antibody
This is a rabbit polyclonal antibody against Tnfrsf12a. It was validated on Western Blot

Target Description: Tnfrsf12a is a receptor for TNFSF12/TWEAK By similarity and weak inducer of apoptosis in some cell types. Tnfrsf12a promotes angiogenesis and the proliferation of endothelial cells and may modulate cellular adhesion to matrix proteins.
Product Categories/Family for anti-TNFRSF12A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 12A isoform 1
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 12a
NCBI Official Symbol
Tnfrsf12a
NCBI Official Synonym Symbols
Fn14; HPIP; C87282; TweakR; TWEAK-R; AI255180
NCBI Protein Information
tumor necrosis factor receptor superfamily member 12A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 12A
UniProt Gene Name
Tnfrsf12a
UniProt Synonym Gene Names
Fgfrp2; Fn14; FGF-inducible 14; TweakR
UniProt Entry Name
TNR12_MOUSE

Uniprot Description

TweakR: Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins. Associates with TRAF1 and TRAF2, and probably also with TRAF3. By FGF1 and phorbol ester. Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Receptor, misc.; Cell development/differentiation

Cellular Component: ruffle; cell surface; membrane; plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: positive regulation of apoptosis; substrate-bound cell migration, cell attachment to substrate; apoptosis; multicellular organismal development; positive regulation of axon extension; angiogenesis; cell adhesion; cell differentiation; regulation of angiogenesis

Research Articles on TNFRSF12A

Similar Products

Product Notes

The TNFRSF12A tnfrsf12a (Catalog #AAA3210313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tnfrsf12a antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tnfrsf12a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFRSF12A tnfrsf12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MASAWPRSLP QILVLGFGLV LMRAAAGEQA PGTSPCSSGS SWSADLDKCM. It is sometimes possible for the material contained within the vial of "Tnfrsf12a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.