Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit BARHL2 Polyclonal Antibody | anti-BARHL2 antibody

BARHL2 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
BARHL2; Polyclonal Antibody; BARHL2 antibody - middle region; anti-BARHL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
Sequence Length
387
Applicable Applications for anti-BARHL2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BARHL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Human Lung)

Immunohistochemistry (IHC) (Human Lung)

Western Blot (WB)

(WB Suggested Anti-BARHL2 Antibody Titration: 0.05-2.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-BARHL2 Antibody Titration: 0.05-2.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-BARHL2 antibody
This is a rabbit polyclonal antibody against BARHL2. It was validated on Western Blot and immunohistochemistry

Target Description: BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
barH-like 2 homeobox protein
NCBI Official Synonym Full Names
BarH like homeobox 2
NCBI Official Symbol
BARHL2
NCBI Protein Information
barH-like 2 homeobox protein
UniProt Protein Name
BarH-like 2 homeobox protein
UniProt Gene Name
BARHL2
UniProt Entry Name
BARH2_HUMAN

Uniprot Description

BARHL2: Potential regulator of neural basic helix-loop-helix genes. Belongs to the BAR homeobox family.

Chromosomal Location of Human Ortholog: 1p22.2

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: sequence-specific DNA binding

Biological Process: neuron differentiation; positive regulation of translation; transcription, DNA-dependent; neuron migration; positive regulation of transcription from RNA polymerase II promoter; cell fate determination; regulation of axon extension

Similar Products

Product Notes

The BARHL2 barhl2 (Catalog #AAA3200683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BARHL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BARHL2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the BARHL2 barhl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSPHHTPKQE SNAVHESFRP KLEQEDSKTK LDKREDSQSD IKCHGTKEEG. It is sometimes possible for the material contained within the vial of "BARHL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.