SDS-Page
(Recombinant Human TNFRSF12A/FN14/TWEAKR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-45 kDa.)
TNFRSF12A/FN14/TWEAKR Active Protein | TNFRSF12A active protein
Recombinant Human TNFRSF12A/FN14/TWEAKR Protein
Gene Names
TNFRSF12A; FN14; CD266; TWEAKR
Purity
>90% by SDS-PAGE.
Synonyms
TNFRSF12A/FN14/TWEAKR; Recombinant Human TNFRSF12A/FN14/TWEAKR Protein; CD266; FN14; TWEAKR; TNFRSF12A active protein
Host
HEK293 Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
Sequence Length
129
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to inhibit TWEAK-induced apoptosis in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 2-12 ug/mL in the presence of 1 ug/mL recombinant human TWEAK.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human TNFRSF12A/FN14/TWEAKR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-45 kDa.)
SDS-Page
(Recombinant Human TNFRSF12A/FN14/TWEAKR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-45 kDa.)
Related Product Information for TNFRSF12A active protein
Description: Recombinant Human TNFRSF12A/FN14/TWEAKR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu28-Trp79) of human TNFRSF12A/FN14/TWEAKR (Accession #NP_057723.1) fused with an Fc, 6xHis tag at the C-terminus.
Background: Fn14 (tumor necrosis factor receptor superfamily, member 12A), also known as TNFRSF12A, is the receptor for TNFSF12/TWEAK. Human and mouse TNFRSF12A share 82% aa sequence identity. TNFRSF12A transcript was expressed at high levels in heart, placenta, and kidney, at intermediate levels in lung, skeletal muscle, and pancreas, and at low levels in brain and liver. In addition, elevated TNFRSF12A expression was found in human liver cancer cell lines and hepatocellular carcinoma specimens. TNFRSF12A is the weak inducer of apoptosis in some cell types. It promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A may modulate cellular adhesion to matrix proteins.
Background: Fn14 (tumor necrosis factor receptor superfamily, member 12A), also known as TNFRSF12A, is the receptor for TNFSF12/TWEAK. Human and mouse TNFRSF12A share 82% aa sequence identity. TNFRSF12A transcript was expressed at high levels in heart, placenta, and kidney, at intermediate levels in lung, skeletal muscle, and pancreas, and at low levels in brain and liver. In addition, elevated TNFRSF12A expression was found in human liver cancer cell lines and hepatocellular carcinoma specimens. TNFRSF12A is the weak inducer of apoptosis in some cell types. It promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A may modulate cellular adhesion to matrix proteins.
Product Categories/Family for TNFRSF12A active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 12A
NCBI Official Synonym Full Names
TNF receptor superfamily member 12A
NCBI Official Symbol
TNFRSF12A
NCBI Official Synonym Symbols
FN14; CD266; TWEAKR
NCBI Protein Information
tumor necrosis factor receptor superfamily member 12A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 12A
Protein Family
UniProt Gene Name
TNFRSF12A
UniProt Synonym Gene Names
FN14; FGF-inducible 14; TweakR
UniProt Entry Name
TNR12_HUMAN
Uniprot Description
TweakR: Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins. Associates with TRAF1 and TRAF2, and probably also with TRAF3. By FGF1 and phorbol ester. Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Receptor, misc.; Motility/polarity/chemotaxis; Cell development/differentiation
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: ruffle; cell surface; plasma membrane; integral to membrane
Molecular Function: protein binding
Biological Process: substrate-bound cell migration, cell attachment to substrate; positive regulation of apoptosis; positive regulation of axon extension; angiogenesis; regulation of angiogenesis
Research Articles on TNFRSF12A
Similar Products
Product Notes
The TNFRSF12A tnfrsf12a (Catalog #AAA9141709) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DFRKDLGWKW IHEPKGYHAN FCLGPCPYIW SLDTQYSKVL ALYNQHNPGA SAAPCCVPQA. It is sometimes possible for the material contained within the vial of "TNFRSF12A/FN14/TWEAKR, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
