Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit TMEM126B Polyclonal Antibody | anti-TMEM126B antibody

TMEM126B antibody - N-terminal region

Gene Names
TMEM126B; HT007; MC1DN29
Reactivity
Dog, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM126B; Polyclonal Antibody; TMEM126B antibody - N-terminal region; anti-TMEM126B antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT
Sequence Length
200
Applicable Applications for anti-TMEM126B antibody
Western Blot (WB)
Homology
Dog: 86%; Human: 100%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM126B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TMEM126B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateTMEM126B is supported by BioGPS gene expression data to be expressed in MCF7)

Related Product Information for anti-TMEM126B antibody
This is a rabbit polyclonal antibody against TMEM126B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: It belongs to the TMEM126 family. The function remains unknown.
Product Categories/Family for anti-TMEM126B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
complex I assembly factor TMEM126B, mitochondrial isoform a
NCBI Official Synonym Full Names
transmembrane protein 126B
NCBI Official Symbol
TMEM126B
NCBI Official Synonym Symbols
HT007; MC1DN29
NCBI Protein Information
complex I assembly factor TMEM126B, mitochondrial
UniProt Protein Name
Complex I assembly factor TMEM126B, mitochondrial
Protein Family
UniProt Gene Name
TMEM126B
UniProt Synonym Gene Names
HT007
UniProt Entry Name
T126B_HUMAN

NCBI Description

This gene encodes a mitochondrial transmembrane protein which is a component of the mitochondrial complex I assembly complex. The encoded protein serves as an assembly factor that is required for formation of the membrane arm of the complex. It interacts with NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 13. Naturally occurring mutations in this gene are associated with isolated complex I deficiency. A pseudogene of this gene has been defined on chromosome 9. [provided by RefSeq, Apr 2017]

Research Articles on TMEM126B

Similar Products

Product Notes

The TMEM126B tmem126b (Catalog #AAA3209407) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM126B antibody - N-terminal region reacts with Dog, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM126B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM126B tmem126b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AASMHGQPSP SLEDAKLRRP MVIEIIEKNF DYLRKEMTQN IYQMATFGTT. It is sometimes possible for the material contained within the vial of "TMEM126B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual