Western Blot (WB)
(Host: RabbitTarget Name: TMEM63CSample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)
Rabbit TMEM63C Polyclonal Antibody | anti-TMEM63C antibody
TMEM63C antibody - middle region
Gene Names
TMEM63C; CSC1; hsCSC1; C14orf171
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM63C; Polyclonal Antibody; TMEM63C antibody - middle region; anti-TMEM63C antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM
Sequence Length
806
Applicable Applications for anti-TMEM63C antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMEM63C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TMEM63CSample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TMEM63CSample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-TMEM63C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TMEM63C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-TMEM63C antibody
This is a rabbit polyclonal antibody against TMEM63C. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of the protein remains unknown.
Target Description: The specific function of the protein remains unknown.
Product Categories/Family for anti-TMEM63C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
calcium permeable stress-gated cation channel 1
NCBI Official Synonym Full Names
transmembrane protein 63C
NCBI Official Symbol
TMEM63C
NCBI Official Synonym Symbols
CSC1; hsCSC1; C14orf171
NCBI Protein Information
calcium permeable stress-gated cation channel 1
UniProt Protein Name
Calcium permeable stress-gated cation channel 1
UniProt Gene Name
TMEM63C
UniProt Synonym Gene Names
C14orf171; CSC1
UniProt Entry Name
CSC1_HUMAN
Research Articles on TMEM63C
Similar Products
Product Notes
The TMEM63C tmem63c (Catalog #AAA3209490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM63C antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM63C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM63C tmem63c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEEIQTVFDM EPSSTSSTPT SLLYVATVLQ EPELNLTPAS SPARHTYGTM. It is sometimes possible for the material contained within the vial of "TMEM63C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
