Western Blot (WB)
(WB Suggested Anti-TMEM126B Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit TMEM126B Polyclonal Antibody | anti-TMEM126B antibody
TMEM126B antibody - middle region
Gene Names
TMEM126B; HT007; MC1DN29
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TMEM126B; Polyclonal Antibody; TMEM126B antibody - middle region; anti-TMEM126B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC
Sequence Length
200
Applicable Applications for anti-TMEM126B antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMEM126B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TMEM126B Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-TMEM126B Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TMEM126B antibody
This is a rabbit polyclonal antibody against TMEM126B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function remains unknown.
Target Description: The function remains unknown.
Product Categories/Family for anti-TMEM126B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23kDa
NCBI Official Full Name
complex I assembly factor TMEM126B, mitochondrial isoform a
NCBI Official Synonym Full Names
transmembrane protein 126B
NCBI Official Symbol
TMEM126B
NCBI Official Synonym Symbols
HT007; MC1DN29
NCBI Protein Information
complex I assembly factor TMEM126B, mitochondrial
Protein Family
NCBI Description
This gene encodes a mitochondrial transmembrane protein which is a component of the mitochondrial complex I assembly complex. The encoded protein serves as an assembly factor that is required for formation of the membrane arm of the complex. It interacts with NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 13. Naturally occurring mutations in this gene are associated with isolated complex I deficiency. A pseudogene of this gene has been defined on chromosome 9. [provided by RefSeq, Apr 2017]
Research Articles on TMEM126B
Similar Products
Product Notes
The TMEM126B (Catalog #AAA3209408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM126B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM126B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM126B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFRSSLIGIV CGVFYPSSLA FTKNGRLATK YHTVPLPPKG RVLIHWMTLC. It is sometimes possible for the material contained within the vial of "TMEM126B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
