Western Blot (WB)
(WB Suggested Anti-Fmo4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Brain)
Rabbit Fmo4 Polyclonal Antibody | anti-FMO4 antibody
Fmo4 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fmo4; Polyclonal Antibody; Fmo4 antibody - middle region; anti-FMO4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQV
Sequence Length
560
Applicable Applications for anti-FMO4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Fmo4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Brain)
Western Blot (WB)
(WB Suggested Anti-Fmo4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Brain)
Related Product Information for anti-FMO4 antibody
This is a rabbit polyclonal antibody against Fmo4. It was validated on Western Blot
Target Description: This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.
Target Description: This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.
Product Categories/Family for anti-FMO4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
dimethylaniline monooxygenase
NCBI Official Synonym Full Names
flavin containing monooxygenase 4
NCBI Official Symbol
Fmo4
NCBI Protein Information
dimethylaniline monooxygenase [N-oxide-forming] 4
UniProt Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 4
Protein Family
UniProt Gene Name
Fmo4
UniProt Synonym Gene Names
FMO 4
UniProt Entry Name
FMO4_RAT
Uniprot Description
FMO4: This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Belongs to the FMO family.
Protein type: Endoplasmic reticulum; Membrane protein, integral; Oxidoreductase; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 1.14.13.8
Cellular Component: endoplasmic reticulum membrane; integral to membrane
Molecular Function: FAD binding; flavin-containing monooxygenase activity; monooxygenase activity; NADP binding
Biological Process: drug catabolic process; drug metabolic process
Research Articles on FMO4
Similar Products
Product Notes
The FMO4 fmo4 (Catalog #AAA3207685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fmo4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Fmo4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FMO4 fmo4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGIHKFKGQI LHSQEYRIPD AFRGKRILVV GLGNTGGDVA VELSGIAAQV. It is sometimes possible for the material contained within the vial of "Fmo4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
