C-C motif chemokine 25 Recombinant Protein | Ccl25 recombinant protein

Recombinant Mouse C-C motif chemokine 25

Cat. Num. AAA1265399

• Gene Names: Ccl25; TECK; CKb15; Scya25; AI852536; A130072A22Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 25; Recombinant Mouse C-C motif chemokine 25; Chemokine TECK; Small-inducible cytokine A25; Thymus-expressed chemokine; Ccl25 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-144. Partial.
• Sequence: GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
• Sequence Length: 144

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Ccl25 recombinant protein

Potentially involved in T-cell development. Recombinant protein shows chotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

References

TECK a novel CC chemokine specifically expressed by thymic dendritic cells and potentially involved in T cell development.Vicari A.P., Figueroa D.J., Hedrick J.A., Foster J.S., Singh K.P., Menon S., Copeland N.G., Gilbert D.J., Jenkins N.A., Bacon K.B., Zlotnik A.Immunity 7:291-301(1997) The chemokine TECK is expressed by thymic and intestinal epithelial cells and attracts double- and single-positive thymocytes expressing the TECK receptor CCR9.Wurbel M.A., Philippe J.-M., Nguyen C., Victorero G., Freeman T., Wooding P., Miazek A., Mattei M.-G., Malissen M., Jordan B.R., Malissen B., Carrier A., Naquet P.3.3.CO;2-S>Eur. J. Immunol. 30:262-271(2000) Functional characterization of the CCL25 promoter in small intestinal epithelial cells suggests a regulatory role for caudal-related homeobox (Cdx) transcription factors.Ericsson A., Kotarsky K., Svensson M., Sigvardsson M., Agace W.J. Immunol. 176:3642-3651(2006) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 6677881
• NCBI GeneID: 20300
• NCBI Accession #: NP_033164.1
• NCBI GenBank Nucleotide #: NM_009138.3
• UniProt Accession #: O35903; Q9QYY6
• Molecular Weight: 18 kDa
• NCBI Official Full Name: C-C motif chemokine 25
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 25
• NCBI Official Symbol: Ccl25
• NCBI Official Synonym Symbols: TECK; CKb15; Scya25; AI852536; A130072A22Rik
• NCBI Protein Information: C-C motif chemokine 25
• UniProt Protein Name: C-C motif chemokine 25
• Protein Family: C-C motif chemokine
• UniProt Gene Name: Ccl25
• UniProt Synonym Gene Names: Scya25; Teck
• UniProt Entry Name: CCL25_MOUSE

Uniprot Description

CCL25: Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Belongs to the intercrine beta (chemokine CC) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Chemokine; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Cellular Component: extracellular space

Molecular Function: CCR chemokine receptor binding; CCR10 chemokine receptor binding; chemokine activity; chemokine receptor binding; protein binding

Biological Process: chemotaxis; G-protein coupled receptor protein signaling pathway; inflammatory response; leukocyte migration; lymphocyte chemotaxis; monocyte chemotaxis; neutrophil chemotaxis; positive regulation of cell-matrix adhesion; positive regulation of GTPase activity