Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FMO4Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit FMO4 Polyclonal Antibody | anti-FMO4 antibody

FMO4 antibody - N-terminal region

Gene Names
FMO4; FMO2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FMO4; Polyclonal Antibody; FMO4 antibody - N-terminal region; anti-FMO4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG
Sequence Length
558
Applicable Applications for anti-FMO4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FMO4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FMO4Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FMO4Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: FMO4Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FMO4Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-FMO4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-FMO4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-FMO4 antibody
This is a rabbit polyclonal antibody against FMO4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
dimethylaniline monooxygenase
NCBI Official Synonym Full Names
flavin containing monooxygenase 4
NCBI Official Symbol
FMO4
NCBI Official Synonym Symbols
FMO2
NCBI Protein Information
dimethylaniline monooxygenase [N-oxide-forming] 4
UniProt Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 4
UniProt Gene Name
FMO4
UniProt Synonym Gene Names
FMO2; FMO 4
UniProt Entry Name
FMO4_HUMAN

NCBI Description

Metabolic N-oxidation of diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man. This results in a small subpopulation with reduced TMA N-oxidation capacity and causes fish odor syndrome (Trimethylaminuria). Three forms of the enzyme are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. [provided by RefSeq, Jan 2015]

Uniprot Description

FMO4: This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Belongs to the FMO family.

Protein type: Membrane protein, integral; EC 1.14.13.8; Oxidoreductase; Xenobiotic Metabolism - drug metabolism - cytochrome P450

Chromosomal Location of Human Ortholog: 1q24.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: FAD binding; NADP binding; flavin-containing monooxygenase activity

Biological Process: drug catabolic process

Research Articles on FMO4

Similar Products

Product Notes

The FMO4 fmo4 (Catalog #AAA3207684) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FMO4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FMO4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FMO4 fmo4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MVCTGHFLNP HLPLEAFPGI HKFKGQILHS QEYKIPEGFQ GKRVLVIGLG. It is sometimes possible for the material contained within the vial of "FMO4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.