Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FMO3 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateFMO3 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Rabbit FMO3 Polyclonal Antibody | anti-FMO3 antibody

FMO3 antibody - N-terminal region

Gene Names
FMO3; TMAU; FMOII; dJ127D3.1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FMO3; Polyclonal Antibody; FMO3 antibody - N-terminal region; anti-FMO3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG
Sequence Length
532
Applicable Applications for anti-FMO3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FMO3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FMO3 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateFMO3 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB) (WB Suggested Anti-FMO3 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateFMO3 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)
Related Product Information for anti-FMO3 antibody
This is a rabbit polyclonal antibody against FMO3. It was validated on Western Blot

Target Description: FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
dimethylaniline monooxygenase
NCBI Official Synonym Full Names
flavin containing monooxygenase 3
NCBI Official Symbol
FMO3
NCBI Official Synonym Symbols
TMAU; FMOII; dJ127D3.1
NCBI Protein Information
dimethylaniline monooxygenase [N-oxide-forming] 3
UniProt Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 3
UniProt Gene Name
FMO3
UniProt Synonym Gene Names
FMO 3
UniProt Entry Name
FMO3_HUMAN

NCBI Description

Flavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-,sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pesticides, and other foreign compounds. The human FMO gene family is composed of 5 genes and multiple pseudogenes. FMO members have distinct developmental- and tissue-specific expression patterns. The expression of this FMO3 gene, the major FMO expressed in adult liver, can vary up to 20-fold between individuals. This inter-individual variation in FMO3 expression levels is likely to have significant effects on the rate at which xenobiotics are metabolised and, therefore, is of considerable interest to the pharmaceutical industry. This transmembrane protein localizes to the endoplasmic reticulum of many tissues. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Mutations in this gene cause the disorder trimethylaminuria (TMAu) which is characterized by the accumulation and excretion of unmetabolized trimethylamine and a distinctive body odor. In healthy individuals, trimethylamine is primarily converted to the non odorous trimethylamine N-oxide.[provided by RefSeq, Jan 2016]

Uniprot Description

FMO3: Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds. Defects in FMO3 are the cause of trimethylaminuria (TMAU); also known as fish-odor syndrome. TMAU is an inborn error of metabolism associated with an offensive body odor and caused by deficiency of FMO-mediated N-oxidation of amino- trimethylamine (TMA) derived from foodstuffs. Such individuals excrete relatively large amounts of TMA in their urine, sweat, and breath, and exhibit a fishy body odor characteristic of the malodorous free amine. Belongs to the FMO family.

Protein type: EC 1.14.13.8; EC 1.14.13.148; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Oxidoreductase

Chromosomal Location of Human Ortholog: 1q24.3

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; integral to membrane

Molecular Function: amino acid binding; FAD binding; NADP binding; flavin-containing monooxygenase activity

Biological Process: xenobiotic metabolic process; drug metabolic process

Disease: Trimethylaminuria

Research Articles on FMO3

Similar Products

Product Notes

The FMO3 fmo3 (Catalog #AAA3207367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FMO3 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's FMO3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FMO3 fmo3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGKKVAIIGA GVSGLASIRS CLEEGLEPTC FEKSNDIGGL WKFSDHAEEG. It is sometimes possible for the material contained within the vial of "FMO3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.