Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-POU5F1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit POU5F1 Polyclonal Antibody | anti-POU5F1 antibody

POU5F1 antibody - middle region

Gene Names
POU5F1; OCT3; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POU5F1; Polyclonal Antibody; POU5F1 antibody - middle region; anti-POU5F1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQC
Sequence Length
265
Applicable Applications for anti-POU5F1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POU5F1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-POU5F1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-POU5F1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-POU5F1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-POU5F1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-POU5F1 antibody
This is a rabbit polyclonal antibody against POU5F1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POU5F1 is a POU transcription factor expressed by early embryo cells and germ cells. It determines paracrine growth factor signaling from stem cells to the trophectoderm.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
POU domain, class 5, transcription factor 1 isoform 2
NCBI Official Synonym Full Names
POU class 5 homeobox 1
NCBI Official Symbol
POU5F1
NCBI Official Synonym Symbols
OCT3; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4
NCBI Protein Information
POU domain, class 5, transcription factor 1
UniProt Protein Name
POU domain, class 5, transcription factor 1
UniProt Gene Name
POU5F1
UniProt Synonym Gene Names
OCT3; OCT4; OTF3; Oct-3; Oct-4; OTF-3
UniProt Entry Name
PO5F1_HUMAN

NCBI Description

This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013]

Uniprot Description

Oct4: Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. Interacts with UBE2I and ZSCAN10. Interacts with PKM2. Interacts with WWP2. Transcriptional activity is positively regulated by PKM2. Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues. Belongs to the POU transcription factor family. Class- 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 6p21.31

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; miRNA binding; DNA binding; sequence-specific DNA binding; ubiquitin protein ligase binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; blastocyst development; anatomical structure morphogenesis; regulation of asymmetric cell division; regulation of transcription, DNA-dependent; regulation of gene expression; somatic stem cell maintenance; endodermal cell fate specification; response to wounding; positive regulation of transcription from RNA polymerase II promoter; mRNA transcription from RNA polymerase II promoter

Research Articles on POU5F1

Similar Products

Product Notes

The POU5F1 pou5f1 (Catalog #AAA3205004) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POU5F1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's POU5F1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POU5F1 pou5f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLQKWVEEAD NNENLQEICK AETLVQARKR KRTSIENRVR GNLENLFLQC. It is sometimes possible for the material contained within the vial of "POU5F1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.