SDS-PAGE
P2X purinoceptor 4 (P2rx4) Recombinant Protein | P2rx4 recombinant protein
Recombinant Mouse P2X purinoceptor 4 (P2rx4), partial
Gene Names
P2rx4; P2X4; AI504491; AW555605; D5Ertd444e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
P2X purinoceptor 4 (P2rx4); Recombinant Mouse P2X purinoceptor 4 (P2rx4); partial; ATP receptor Purinergic receptor; P2rx4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
55-338aa; Extracellular Domain
Sequence
QETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMIN
Sequence Length
339
Species
Mus musculus (Mouse)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for P2rx4 recombinant protein
Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin (By similarity).
Product Categories/Family for P2rx4 recombinant protein
References
"Alternatively spliced variants of the mouse P2X4 receptor: cloning and characterisation."Simon J., Michel A.D., Chessell I.P., Kidd E.J., Jones C.A., Barnard E.A., Humphrey P.P.Submitted (DEC-1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
47.5 kDa
NCBI Official Full Name
P2X purinoceptor 4
NCBI Official Synonym Full Names
purinergic receptor P2X, ligand-gated ion channel 4
NCBI Official Symbol
P2rx4
NCBI Official Synonym Symbols
P2X4; AI504491; AW555605; D5Ertd444e
NCBI Protein Information
P2X purinoceptor 4
UniProt Protein Name
P2X purinoceptor 4
Protein Family
UniProt Gene Name
P2rx4
UniProt Synonym Gene Names
P2x4; P2X4
Uniprot Description
Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin ().
Research Articles on P2rx4
Similar Products
Product Notes
The P2rx4 p2rx4 (Catalog #AAA7053587) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 55-338aa; Extracellular Domain. The amino acid sequence is listed below: QETDSVVSSV TTKAKGVAVT NTSQLGFRIW DVADYVVPAQ EENSLFIMTN MIVTVNQTQG TCPEIPDKTS ICDSDANCTL GSSDTHSSGI GTGRCVPFNA SVKTCEVAAW CPVENDAGVP TPAFLKAAEN FTLLVKNNIW YPKFNFSKRN ILPNITTSYL KSCIYNARTD PFCPIFRLGQ IVADAGHSFQ EMAVEGGIMG IQIKWDCNLD RAASHCLPRY SFRRLDTRDL EHNVSPGYNF RFAKYYRDLA GNEQRTLTKA YGIRFDIIVF GKAGKFDIIP TMIN. It is sometimes possible for the material contained within the vial of "P2X purinoceptor 4 (P2rx4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
