Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BAZ1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateBAZ1B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit BAZ1B Polyclonal Antibody | anti-BAZ1B antibody

BAZ1B antibody - middle region

Gene Names
BAZ1B; WSTF; WBSCR9; WBSCR10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BAZ1B; Polyclonal Antibody; BAZ1B antibody - middle region; anti-BAZ1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQK
Sequence Length
1483
Applicable Applications for anti-BAZ1B antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BAZ1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BAZ1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateBAZ1B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-BAZ1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateBAZ1B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-BAZ1B antibody
This is a rabbit polyclonal antibody against BAZ1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BAZ1B is a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
171kDa
NCBI Official Full Name
tyrosine-protein kinase BAZ1B
NCBI Official Synonym Full Names
bromodomain adjacent to zinc finger domain 1B
NCBI Official Symbol
BAZ1B
NCBI Official Synonym Symbols
WSTF; WBSCR9; WBSCR10
NCBI Protein Information
tyrosine-protein kinase BAZ1B
UniProt Protein Name
Tyrosine-protein kinase BAZ1B
Protein Family
UniProt Gene Name
BAZ1B
UniProt Synonym Gene Names
WBSC10; WBSCR10; WBSCR9; WSTF
UniProt Entry Name
BAZ1B_HUMAN

NCBI Description

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008]

Uniprot Description

WSTF: plays a central role in chromatin remodeling and acts as a transcription regulator. Apparently possesses tyrosine-protein kinase activity, but bears no sequence resemblance classical tyrosine kinase proteins. Involved in DNA damage response by phosphorylating Y142 of histone H2AX. H2AXpY142 plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Essential component of the WICH complex, a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. The WICH complex regulates the transcription of various genes, has a role in RNA polymerase I and RNA polymerase III transcription, mediates the histone H2AX phosphorylation at Y142, and is involved in the maintenance of chromatin structures during DNA replication processes. In the complex, it mediates the recruitment of the WICH complex to replication foci during DNA replication. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. In the WINAC complex, plays an essential role by targeting the complex to acetylated histones, an essential step for VDR-promoter association. Accumulates in pericentromeric heterochromatin during replication. Targeted to replication foci throughout S phase via its association with PCNA. Ubiquitously expressed with high levels of expression in heart, brain, placenta, skeletal muscle and ovary. Two alternatively-spliced human isoforms have been reported.

Protein type: Protein kinase, Ser/Thr (non-receptor); DNA replication; Kinase, protein; EC 2.7.10.2; Nuclear receptor co-regulator; ATYPICAL group; BAZ family

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: centric heterochromatin; nuclear replication fork; condensed chromosome

Molecular Function: protein binding; zinc ion binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; histone kinase activity; chromatin binding; ATP binding

Biological Process: chromatin assembly or disassembly; heart morphogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; chromatin-mediated maintenance of transcription; histone phosphorylation; double-strand break repair; response to DNA damage stimulus

Research Articles on BAZ1B

Similar Products

Product Notes

The BAZ1B baz1b (Catalog #AAA3204707) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAZ1B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BAZ1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BAZ1B baz1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQCLVALLHK HLPGHPYVRR KRKKFPDRLA EDEGDSEPEA VGQSRGRRQK. It is sometimes possible for the material contained within the vial of "BAZ1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.