Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Lung )

Rabbit anti-Horse, Human CIZ1 Polyclonal Antibody | anti-CIZ1 antibody

CIZ1 antibody - C-terminal region

Gene Names
CIZ1; NP94; LSFR1; ZNF356
Reactivity
Horse, Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CIZ1; Polyclonal Antibody; CIZ1 antibody - C-terminal region; anti-CIZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
Sequence Length
898
Applicable Applications for anti-CIZ1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Horse: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CIZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(WB Suggested Anti-CIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-CIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-CIZ1 antibody
This is a rabbit polyclonal antibody against CIZ1. It was validated on Western Blot and immunohistochemistry

Target Description: CIZ1 may regulate the subcellular localization of CIP/WAF1.
Product Categories/Family for anti-CIZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100kDa
NCBI Official Full Name
cip1-interacting zinc finger protein isoform 1
NCBI Official Synonym Full Names
CDKN1A interacting zinc finger protein 1
NCBI Official Symbol
CIZ1
NCBI Official Synonym Symbols
NP94; LSFR1; ZNF356
NCBI Protein Information
cip1-interacting zinc finger protein
UniProt Protein Name
Cip1-interacting zinc finger protein
UniProt Gene Name
CIZ1
UniProt Synonym Gene Names
LSFR1; NP94; ZNF356
UniProt Entry Name
CIZ1_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger DNA binding protein that interacts with CIP1, part of a complex with cyclin E. The encoded protein may regulate the cellular localization of CIP1. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Research Articles on CIZ1

Similar Products

Product Notes

The CIZ1 ciz1 (Catalog #AAA3204363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIZ1 antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CIZ1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CIZ1 ciz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKAAKNPSPT TRPVSRRCAI NARNALTALF TSSGRPPSQP NTQDKTPSKV. It is sometimes possible for the material contained within the vial of "CIZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.