Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of mouse testis, using CIZ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit anti-Human, Mouse CIZ1 Polyclonal Antibody | anti-CIZ1 antibody

CIZ1 Rabbit pAb

Gene Names
CIZ1; NP94; LSFR1; ZNF356
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
CIZ1; Polyclonal Antibody; CIZ1 Rabbit pAb; LSFR1; NP94; ZNF356; anti-CIZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PGQLQVKAQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQVQPQLQQEAEPQKQVQPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQN
Applicable Applications for anti-CIZ1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation:
WB: Human
IF: Human
IHC: Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 250-440 of human CIZ1 (NP_001124490).
Positive Samples
mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of mouse testis, using CIZ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of mouse testis, using CIZ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-CIZ1 antibody
Background: The protein encoded by this gene is a zinc finger DNA binding protein that interacts with CIP1, part of a complex with cyclin E. The encoded protein may regulate the cellular localization of CIP1. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
100,045 Da
NCBI Official Full Name
cip1-interacting zinc finger protein isoform 2
NCBI Official Synonym Full Names
CDKN1A interacting zinc finger protein 1
NCBI Official Symbol
CIZ1
NCBI Official Synonym Symbols
NP94; LSFR1; ZNF356
NCBI Protein Information
cip1-interacting zinc finger protein; nuclear protein NP94; zinc finger protein 356
UniProt Protein Name
Cip1-interacting zinc finger protein
UniProt Gene Name
CIZ1
UniProt Synonym Gene Names
LSFR1; NP94; ZNF356
UniProt Entry Name
CIZ1_HUMAN

Similar Products

Product Notes

The CIZ1 ciz1 (Catalog #AAA9142735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIZ1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CIZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Human IF: Human IHC: Human. Researchers should empirically determine the suitability of the CIZ1 ciz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PGQLQVKAQP QARMTVPKQT QTPDLLPEAL EAQVLPRFQP RVLQVQAQVQ SQTQPRIPST DTQVQPKLQK QAQTQTSPEH LVLQQKQVQP QLQQEAEPQK QVQPQVHTQA QPSVQPQEHP PAQVSVQPPE QTHEQPHTQP QVSLLAPEQT PVVVHVCGLE MPPDAVEAGG GMEKTLPEPV GTQVSMEEIQ N. It is sometimes possible for the material contained within the vial of "CIZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.