Western Blot (WB)
(Host: RabbitTarget Name: Cnot8Antibody Dilution: 1.0ug/mlSample Type: Mouse Testis)
Rabbit Cnot8 Polyclonal Antibody | anti-CNOT8 antibody
Cnot8 antibody - C-terminal region
Gene Names
Cnot8; AA536816; AU015770; AU043059; 1500015I04Rik; 1810022F04Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cnot8; Polyclonal Antibody; Cnot8 antibody - C-terminal region; anti-CNOT8 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAM
Sequence Length
292
Applicable Applications for anti-CNOT8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Cnot8Antibody Dilution: 1.0ug/mlSample Type: Mouse Testis)
Western Blot (WB)
(Host: RabbitTarget Name: Cnot8Antibody Dilution: 1.0ug/mlSample Type: Mouse Testis)
Related Product Information for anti-CNOT8 antibody
This is a rabbit polyclonal antibody against Cnot8. It was validated on Western Blot
Target Description: Cnot8 is a ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.
Target Description: Cnot8 is a ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.
Product Categories/Family for anti-CNOT8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
CCR4-NOT transcription complex subunit 8
NCBI Official Synonym Full Names
CCR4-NOT transcription complex, subunit 8
NCBI Official Symbol
Cnot8
NCBI Official Synonym Symbols
AA536816; AU015770; AU043059; 1500015I04Rik; 1810022F04Rik
NCBI Protein Information
CCR4-NOT transcription complex subunit 8
UniProt Protein Name
CCR4-NOT transcription complex subunit 8
Protein Family
UniProt Gene Name
Cnot8
UniProt Entry Name
CNOT8_MOUSE
Research Articles on CNOT8
Similar Products
Product Notes
The CNOT8 cnot8 (Catalog #AAA3204119) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cnot8 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cnot8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNOT8 cnot8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFFRMKELFF EDSIDDAKYC GRLYGLGTGV AQKQNEDVDC AQEKMSILAM. It is sometimes possible for the material contained within the vial of "Cnot8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
